GALNT12 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP214035-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP214035 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
GALNT12
Classification
Polyclonal
Dilution
Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
Gene Alias
colorectal cancer, susceptibility to 1, CRCS1, EC 2.4.1.41, FLJ21212, GalNAc-T12, Polypeptide GalNAc transferase 12, polypeptide N-acetylgalactosaminyltransferase 12, pp-GaNTase 12, Protein-UDP acetylgalactosaminyltransferase 12, UDP-GalNAc: polypeptide N-acetylgalactosaminyltransferase, UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 12, UDP-N-acetyl-alpha-D-galactosamine:polypeptideN-acetylgalactosaminyltransferase 12 (GalNAc-T12)
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Formulation
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols
GALNT12
Immunogen
This antibody was developed against a recombinant protein corresponding to the amino acids: PEGCIAVEAGMDTLIMHLCEETAPENQKFILQEDGSLFHEQSKKCVQAARKESSDSFVPLLRDCTNSDHQK
Quantity
0.1 mL
Research Discipline
Stem Cell Markers
Gene ID (Entrez)
79695
Target Species
Human
Isotype
IgG
Related Products
Description
- GALNT12 Polyclonal specifically detects GALNT12 in Human samples
- It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: GALNT12
Classification: Polyclonal
Dilution: Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
Gene Alias: colorectal cancer, susceptibility to 1, CRCS1, EC 2.4.1.41, FLJ21212, GalNAc-T12, Polypeptide GalNAc transferase 12, polypeptide N-acetylgalactosaminyltransferase 12, pp-GaNTase 12, Protein-UDP acetylgalactosaminyltransferase 12, UDP-GalNAc: polypeptide N-acetylgalactosaminyltransferase, UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 12, UDP-N-acetyl-alpha-D-galactosamine:polypeptideN-acetylgalactosaminyltransferase 12 (GalNAc-T12)
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols: GALNT12
Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: PEGCIAVEAGMDTLIMHLCEETAPENQKFILQEDGSLFHEQSKKCVQAARKESSDSFVPLLRDCTNSDHQK
Quantity: 0.1 mL
Research Discipline: Stem Cell Markers
Gene ID (Entrez): 79695
Target Species: Human
Isotype: IgG
Antigen: GAS8
Classification: Polyclonal
Dilution: Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
Gene Alias: GAS-11, GAS11MGC138326, GAS-8, growth arrest specific 11, growth arrest-specific 11, growth arrest-specific 8, Growth arrest-specific protein 11, growth arrest-specific protein 8
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols: GAS8
Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: VEKKEVQFNEVLAASNLDPAALTLVSRKLEDVLESKNSTIKDLQYELAQVCKAHNDLLRTYEAKLLAFGIPLDNVGFKPLETAVIGQTLGQG
Quantity: 0.1 mL
Research Discipline: __
Gene ID (Entrez): 2622
Target Species: Human
Isotype: IgG
Antigen: GAS8
Classification: Polyclonal
Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500
Gene Alias: GAS-11, GAS11MGC138326, GAS-8, growth arrest specific 11, growth arrest-specific 11, growth arrest-specific 8, Growth arrest-specific protein 11, growth arrest-specific protein 8
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols: GAS8
Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: KKEDHLEREMAEVSGQNKRLADPLQKAREEMSEMQKQLANYERDKQILLCTKARLKVREKELKDLQWEHEVLEQRFTKVQQERDELYRKFTAAIQ
Quantity: 0.1 mL
Research Discipline: __
Gene ID (Entrez): 2622
Target Species: Human
Isotype: IgG
