HUNK Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP214110-Each-of-1 | In Stock | ₹ 55,271.76 |
NBP214110 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 55,271.76
GST (18%): ₹ 9,948.917
Total Price: ₹ 65,220.677
Antigen
HUNK
Classification
Polyclonal
Dilution
Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500
Gene Alias
B19, EC 2.7.11, EC 2.7.11.1, hormonally up-regulated neu tumor-associated kinase, hormonally upregulated neu tumor-associated kinase, hormonally up-regulated Neu-associated kinase, hormonally upregulated Neu-associated kinase, MAKV, serine/threonine protein kinase MAK-V, Serine/threonine-protein kinase MAK-V
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Formulation
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols
HUNK
Immunogen
This antibody was developed against a recombinant protein corresponding to the amino acids: SSFPDKDSFGCRNIFRKTSDSNCVASSSMEFIPVPPPRTPRIVKKPEPHQPGPGSTGIPHKEDPLMLDMVRSFESVDR
Quantity
0.1 mL
Research Discipline
Cancer, GPCR, Protein Kinase
Gene ID (Entrez)
30811
Target Species
Human
Isotype
IgG
Related Products
Description
- HUNK Polyclonal specifically detects HUNK in Human samples
- It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: HUNK
Classification: Polyclonal
Dilution: Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500
Gene Alias: B19, EC 2.7.11, EC 2.7.11.1, hormonally up-regulated neu tumor-associated kinase, hormonally upregulated neu tumor-associated kinase, hormonally up-regulated Neu-associated kinase, hormonally upregulated Neu-associated kinase, MAKV, serine/threonine protein kinase MAK-V, Serine/threonine-protein kinase MAK-V
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols: HUNK
Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: SSFPDKDSFGCRNIFRKTSDSNCVASSSMEFIPVPPPRTPRIVKKPEPHQPGPGSTGIPHKEDPLMLDMVRSFESVDR
Quantity: 0.1 mL
Research Discipline: Cancer, GPCR, Protein Kinase
Gene ID (Entrez): 30811
Target Species: Human
Isotype: IgG
Antigen: __
Classification: __
Dilution: __
Gene Alias: __
Host Species: __
Purification Method: Chromatography
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: SSFPDKDSFGCRNIFRKTSDSNCVASSSMEFIPVPPPRTPRIVKKPEPHQPGPGSTGIPHKEDPLMLDMVRSFESVDR
Quantity: 0.1mL
Research Discipline: __
Gene ID (Entrez): 30811
Target Species: __
Isotype: __
Antigen: HUNK
Classification: Polyclonal
Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
Gene Alias: B19, EC 2.7.11, EC 2.7.11.1, hormonally up-regulated neu tumor-associated kinase, hormonally upregulated neu tumor-associated kinase, hormonally up-regulated Neu-associated kinase, hormonally upregulated Neu-associated kinase, MAKV, serine/threonine protein kinase MAK-V, Serine/threonine-protein kinase MAK-V
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols: HUNK
Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: NSPVSLACRNSSERTLSPGLPSGSMSPLHTPLHPTLVSFAHEDKNSPPKEEGLCCPPPVPSNGPMQPLGSPNCVKSRGRFPMMGIG
Quantity: 0.1 mL
Research Discipline: Cancer, GPCR, Protein Kinase
Gene ID (Entrez): 30811
Target Species: Human
Isotype: IgG