SALM4/LRFN3 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP214199-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP214199 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
SALM4/LRFN3
Classification
Polyclonal
Dilution
Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50
Gene Alias
fibronectin type III, immunoglobulin and leucine rich repeat domains 1, FIGLER1, leucine rich repeat and fibronectin type III domain containing 3, leucine-rich repeat and fibronectin type-III domain-containing protein 3, MGC2656, SALM4, synaptic adhesion-like molecule 4, UNQ5865/PRO34192
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Gene ID (Entrez)
79414
Target Species
Human
Isotype
IgG
Applications
Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Formulation
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols
LRFN3
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: EATAAVELTVGPPPPPQLANSTSCDPPRDGDPDALTPPSAAS
Quantity
0.1 mL
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Related Products
Description
- SALM4/LRFN3 Polyclonal specifically detects SALM4/LRFN3 in Human samples
- It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: SALM4/LRFN3
Classification: Polyclonal
Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50
Gene Alias: fibronectin type III, immunoglobulin and leucine rich repeat domains 1, FIGLER1, leucine rich repeat and fibronectin type III domain containing 3, leucine-rich repeat and fibronectin type-III domain-containing protein 3, MGC2656, SALM4, synaptic adhesion-like molecule 4, UNQ5865/PRO34192
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 79414
Target Species: Human
Isotype: IgG
Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols: LRFN3
Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: EATAAVELTVGPPPPPQLANSTSCDPPRDGDPDALTPPSAAS
Quantity: 0.1 mL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: __
Classification: __
Dilution: __
Gene Alias: __
Host Species: __
Purification Method: Chromatography
Regulatory Status: RUO
Gene ID (Entrez): 79414
Target Species: __
Isotype: __
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: EATAAVELTVGPPPPPQLANSTSCDPPRDGDPDALTPPSAAS
Quantity: 0.1mL
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
Antigen: LRRC41
Classification: Polyclonal
Dilution: Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:500-1:1000
Gene Alias: leucine rich repeat containing 41, leucine-rich repeat-containing protein 41, MGC126571, MGC126573, MUF1 protein (MUF1), MUF1elongin BC-interacting leucine-rich repeat protein, Protein Muf1, RP4-636H5.2
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 10489
Target Species: Human
Isotype: IgG
Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols: LRRC41
Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: KPLKRFKRAAGKKGARTRQGPGAESEDLYDFVFIVAGEKEDGEEMEIGEVACGALDGSDPSCLGLPALEASQRF
Quantity: 0.1 mL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.