MLLT11 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP214237-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP214237 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
MLLT11
Classification
Polyclonal
Dilution
Immunohistochemistry 1:20 - 1:50, Immunocytochemistry/Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:20 - 1:50
Gene Alias
AF1QRP11-316M1.10, ALL1 fused gene from chromosome 1q, ALL1-fused gene from chromosome 1q, myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila);translocated to, 11, protein AF1q
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Formulation
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols
MLLT11
Immunogen
This antibody was developed against a recombinant protein corresponding to the amino acids: FWRMPIPELDLSELEGLGLSDTATYKVKDSSVGKMIGQATAADQEKNPEGDGLLEYSTFNFWRAPIASIHSFEL
Quantity
0.1 mL
Research Discipline
Cancer
Gene ID (Entrez)
10962
Target Species
Human
Isotype
IgG
Related Products
Description
- MLLT11 Polyclonal specifically detects MLLT11 in Human samples
- It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: MLLT11
Classification: Polyclonal
Dilution: Immunohistochemistry 1:20 - 1:50, Immunocytochemistry/Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:20 - 1:50
Gene Alias: AF1QRP11-316M1.10, ALL1 fused gene from chromosome 1q, ALL1-fused gene from chromosome 1q, myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila);translocated to, 11, protein AF1q
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols: MLLT11
Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: FWRMPIPELDLSELEGLGLSDTATYKVKDSSVGKMIGQATAADQEKNPEGDGLLEYSTFNFWRAPIASIHSFEL
Quantity: 0.1 mL
Research Discipline: Cancer
Gene ID (Entrez): 10962
Target Species: Human
Isotype: IgG
Antigen: __
Classification: __
Dilution: __
Gene Alias: __
Host Species: __
Purification Method: Chromatography
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: FWRMPIPELDLSELEGLGLSDTATYKVKDSSVGKMIGQATAADQEKNPEGDGLLEYSTFNFWRAPIASIHSFEL
Quantity: 0.1mL
Research Discipline: __
Gene ID (Entrez): 10962
Target Species: __
Isotype: __
Antigen: MNF1
Classification: Polyclonal
Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:1000 - 1:2500
Gene Alias: bA6B20.2, breast cancer associated protein SGA-81M, Breast cancer-associated protein SGA-81M, C6orf125, Cbp6, chromosome 6 open reading frame 125, hypothetical protein LOC84300, M19, MGC14833, mitochondrial nucleoid factor 1, MNF1
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols: MNF1
Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: NYYKHKYPRPRDTSFSGLSLEEYKLILSTDTLEELKEIDKGMWKKLQEKFAPKGPEADDKA
Quantity: 0.1 mL
Research Discipline: __
Gene ID (Entrez): 84300
Target Species: Human
Isotype: IgG