BRMS1L Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP214362-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP214362 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
BRMS1L
Classification
Polyclonal
Dilution
Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:1000-1:2500
Gene Alias
breast cancer metastasis-suppressor 1, breast cancer metastasis-suppressor 1-like, breast cancer metastasis-suppressor 1-like protein, BRMS1, BRMS1-homolog protein p40, BRMS1-like protein p40, FLJ39177, MGC11296
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Formulation
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols
BRMS1L
Immunogen
This antibody was developed against a recombinant protein corresponding to the amino acids: EDWTTIRKAMATLGPHRVKTEPPVKLEKHLHSARSEEGRLYYDGEWYIRGQTICIDKKDECPTSAVITTINHDEVWFKRPDGSKSK
Quantity
0.1 mL
Research Discipline
DNA Repair
Gene ID (Entrez)
84312
Target Species
Human
Isotype
IgG
Related Products
Description
- BRMS1L Polyclonal specifically detects BRMS1L in Human samples
- It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: BRMS1L
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:1000-1:2500
Gene Alias: breast cancer metastasis-suppressor 1, breast cancer metastasis-suppressor 1-like, breast cancer metastasis-suppressor 1-like protein, BRMS1, BRMS1-homolog protein p40, BRMS1-like protein p40, FLJ39177, MGC11296
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols: BRMS1L
Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: EDWTTIRKAMATLGPHRVKTEPPVKLEKHLHSARSEEGRLYYDGEWYIRGQTICIDKKDECPTSAVITTINHDEVWFKRPDGSKSK
Quantity: 0.1 mL
Research Discipline: DNA Repair
Gene ID (Entrez): 84312
Target Species: Human
Isotype: IgG
Antigen: __
Classification: __
Dilution: __
Gene Alias: __
Host Species: __
Purification Method: Chromatography
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: EDWTTIRKAMATLGPHRVKTEPPVKLEKHLHSARSEEGRLYYDGEWYIRGQTICIDKKDECPTSAVITTINHDEVWFKRPDGSKSK
Quantity: 0.1mL
Research Discipline: __
Gene ID (Entrez): 84312
Target Species: __
Isotype: __
Antigen: Bone marrow stromal cell antigen 1/CD157
Classification: Polyclonal
Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
Gene Alias: ADP-ribosyl cyclase 2, Bone marrow stromal antigen 1, bone marrow stromal cell antigen 1, BST-1, cADPr hydrolase 2, CD157, CD157 antigen, Cyclic ADP-ribose hydrolase 2, EC 3.2.2.5, NAD(+) nucleosidase
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols: BST1
Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: EGTSAHLRDIFLGRCAEYRALLSPEQRNKNCTAIWEAFKVALDKDPCSVLPSDYDLFINLSRHSIPRDKSLFWE
Quantity: 0.1 mL
Research Discipline: Immunology
Gene ID (Entrez): 683
Target Species: Human
Isotype: IgG