BTN2A2/Butyrophilin 2 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP214367-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP214367 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
BTN2A2/Butyrophilin 2
Classification
Polyclonal
Dilution
Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500
Gene Alias
BTF2BT2.2butyrophilin 2, butyrophilin subfamily 2 member A2, butyrophilin, subfamily 2, member A2, FLJ41908
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Gene ID (Entrez)
10385
Target Species
Human
Isotype
IgG
Applications
Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin), Immunoprecipitation
Conjugate
Unconjugated
Formulation
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols
BTN2A2
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: EKKVEQEEKEIAQQLQEELR
Quantity
0.1 mL
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Related Products
Description
- BTN2A2/Butyrophilin 2 Polyclonal specifically detects BTN2A2/Butyrophilin 2 in Human samples
- It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: BTN2A2/Butyrophilin 2
Classification: Polyclonal
Dilution: Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500
Gene Alias: BTF2BT2.2butyrophilin 2, butyrophilin subfamily 2 member A2, butyrophilin, subfamily 2, member A2, FLJ41908
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 10385
Target Species: Human
Isotype: IgG
Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin), Immunoprecipitation
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols: BTN2A2
Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: EKKVEQEEKEIAQQLQEELR
Quantity: 0.1 mL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: __
Classification: __
Dilution: __
Gene Alias: __
Host Species: __
Purification Method: Chromatography
Regulatory Status: RUO
Gene ID (Entrez): 10385
Target Species: __
Isotype: __
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: EKKVEQEEKEIAQQLQEELR
Quantity: 0.1mL
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
Antigen: BTNL8
Classification: Polyclonal
Dilution: Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
Gene Alias: butyrophilin-like 8, butyrophilin-like protein 8, UNQ702/PRO1347
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 79908
Target Species: Human
Isotype: IgG
Applications: Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols: BTNL8
Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: LLRPYIEYPSYNEQNGTPIVICPVTQESEKEASWQRASAIPETSNSESSSQA
Quantity: 0.1 mL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.