Complement Factor H-related 1/CFHR1/CFHL1 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP214475-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP214475 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
Complement Factor H-related 1/CFHR1/CFHL1
Classification
Polyclonal
Dilution
Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50
Gene Alias
CFHL1FHR-1, CFHLCFHR1P, complement factor H-related 1, complement factor H-related 1 pseudogene, complement factor H-related protein 1, FHR1CFHL1P, H factor (complement)-like 1, H factor (complement)-like 2, H factor-like protein 1, H36-1, H36-2, H-factor-like 1, HFL1H36, HFL2, MGC104329
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Gene ID (Entrez)
3078
Target Species
Human
Isotype
IgG
Applications
Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Formulation
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols
CFHR1
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: YKPFSQVPTGEVFYYSCEYNFVSPSKSFWTRITCTEEGWS
Quantity
0.1 mL
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Related Products
Description
- Complement Factor H-related 1/CFHR1/CFHL1 Polyclonal specifically detects Complement Factor H-related 1/CFHR1/CFHL1 in Human samples
- It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: Complement Factor H-related 1/CFHR1/CFHL1
Classification: Polyclonal
Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50
Gene Alias: CFHL1FHR-1, CFHLCFHR1P, complement factor H-related 1, complement factor H-related 1 pseudogene, complement factor H-related protein 1, FHR1CFHL1P, H factor (complement)-like 1, H factor (complement)-like 2, H factor-like protein 1, H36-1, H36-2, H-factor-like 1, HFL1H36, HFL2, MGC104329
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 3078
Target Species: Human
Isotype: IgG
Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols: CFHR1
Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: YKPFSQVPTGEVFYYSCEYNFVSPSKSFWTRITCTEEGWS
Quantity: 0.1 mL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: __
Classification: __
Dilution: __
Gene Alias: __
Host Species: __
Purification Method: Chromatography
Regulatory Status: RUO
Gene ID (Entrez): 3078
Target Species: __
Isotype: __
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: YKPFSQVPTGEVFYYSCEYNFVSPSKSFWTRITCTEEGWS
Quantity: 0.1mL
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
Antigen: CHAC2
Classification: Polyclonal
Dilution: Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500
Gene Alias: cation transport regulator-like protein 2, ChaC, cation transport regulator homolog 2 (E. coli), ChaC, cation transport regulator-like 2, ChaC, cation transport regulator-like 2 (E. coli)
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 494143
Target Species: Human
Isotype: IgG
Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols: CHAC2
Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: LGPAPLEDIAEQIFNAAGPSGRNTEYLFELANSIRNLVPEEADEHLFALEKLVKERLEGKQNLN
Quantity: 0.1 mL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.