Potassium Channel Kv3.1 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP230395-Each-of-1 | In Stock | ₹ 55,271.76 |
NBP230395 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 55,271.76
GST (18%): ₹ 9,948.917
Total Price: ₹ 65,220.677
Antigen
Potassium Channel Kv3.1
Classification
Polyclonal
Dilution
Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:500 - 1:1000
Gene Accession No.
P48547
Gene Symbols
KCNC1
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: EEALDSFGGAPLDNSADDADADGPGDSGDGEDELEMTKRLALSDS
Quantity
0.1 mL
Research Discipline
Neuronal Cell Markers, Neuroscience, Neurotransmission, Potassium Channels
Gene ID (Entrez)
3746
Target Species
Human
Isotype
IgG
Applications
Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Formulation
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias
FLJ41162, FLJ42249, FLJ43491, KV3.1, KV4, MGC129855, NGK2, potassium voltage-gated channel subfamily C member 1, potassium voltage-gated channel, Shaw-related subfamily, member 1, voltage-gated potassium channel protein KV3.1, Voltage-gated potassium channel subunit Kv3.1, Voltage-gated potassium channel subunit Kv4
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Related Products
Description
- Potassium Channel Kv3.1 Polyclonal specifically detects Potassium Channel Kv3.1 in Human samples
- It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: Potassium Channel Kv3.1
Classification: Polyclonal
Dilution: Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:500 - 1:1000
Gene Accession No.: P48547
Gene Symbols: KCNC1
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: EEALDSFGGAPLDNSADDADADGPGDSGDGEDELEMTKRLALSDS
Quantity: 0.1 mL
Research Discipline: Neuronal Cell Markers, Neuroscience, Neurotransmission, Potassium Channels
Gene ID (Entrez): 3746
Target Species: Human
Isotype: IgG
Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: FLJ41162, FLJ42249, FLJ43491, KV3.1, KV4, MGC129855, NGK2, potassium voltage-gated channel subfamily C member 1, potassium voltage-gated channel, Shaw-related subfamily, member 1, voltage-gated potassium channel protein KV3.1, Voltage-gated potassium channel subunit Kv3.1, Voltage-gated potassium channel subunit Kv4
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: __
Classification: __
Dilution: __
Gene Accession No.: __
Gene Symbols: __
Immunogen: EEALDSFGGAPLDNSADDADADGPGDSGDGEDELEMTKRLALSDS
Quantity: 0.1mL
Research Discipline: __
Gene ID (Entrez): 3746
Target Species: __
Isotype: __
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: __
Host Species: __
Purification Method: Chromatography
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
Antigen: DCAF5
Classification: Polyclonal
Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000
Gene Accession No.: Q96JK2
Gene Symbols: DCAF5
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: LWHMEQAIHSRVKPIQLKGEHHSNIFCLAFNSGNTKVFSGGNDEQVILHDVESSETLDVFAHEDAVYGLSVSPVNDNIFASSSDDG
Quantity: 0.1 mL
Research Discipline: __
Gene ID (Entrez): 8816
Target Species: Human
Isotype: IgG
Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: DDB1 and CUL4 associated factor 5, DKFZp434A035, uterine leiomyoma, 2, WDR22
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
