alcohol dehydrogenase 5 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP230636-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP230636 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
alcohol dehydrogenase 5
Classification
Polyclonal
Dilution
Western Blot, Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50
Gene Accession No.
P11766
Gene Symbols
ADH5
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: DYSFECIGNVKVMRAALEACHKGWGVSVVVGVAASGEEIATRPFQLVTGRTWKGTAFG
Quantity
0.1 mL
Research Discipline
Core ESC Like Genes, Stem Cell Markers
Gene ID (Entrez)
128
Target Species
Human, Mouse
Isotype
IgG
Applications
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Formulation
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias
ADH-3, ADHXEC 1.1.1.1, alcohol dehydrogenase (class III), chi polypeptide, Alcohol dehydrogenase 5, alcohol dehydrogenase 5 (class III), chi polypeptide, Alcohol dehydrogenase class chi chain, alcohol dehydrogenase class-3, Alcohol dehydrogenase class-III, EC 1.1.1, EC 1.1.1.-, EC 1.1.1.284, FALDH, FDHGSNOR, formaldehyde dehydrogenase, Glutathione-dependent formaldehyde dehydrogenase, GSH-FDH, S-(hydroxymethyl)glutathione dehydrogenase
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Related Products
Description
- alcohol dehydrogenase 5 Polyclonal specifically detects alcohol dehydrogenase 5 in Human, Mouse samples
- It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: alcohol dehydrogenase 5
Classification: Polyclonal
Dilution: Western Blot, Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50
Gene Accession No.: P11766
Gene Symbols: ADH5
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: DYSFECIGNVKVMRAALEACHKGWGVSVVVGVAASGEEIATRPFQLVTGRTWKGTAFG
Quantity: 0.1 mL
Research Discipline: Core ESC Like Genes, Stem Cell Markers
Gene ID (Entrez): 128
Target Species: Human, Mouse
Isotype: IgG
Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: ADH-3, ADHXEC 1.1.1.1, alcohol dehydrogenase (class III), chi polypeptide, Alcohol dehydrogenase 5, alcohol dehydrogenase 5 (class III), chi polypeptide, Alcohol dehydrogenase class chi chain, alcohol dehydrogenase class-3, Alcohol dehydrogenase class-III, EC 1.1.1, EC 1.1.1.-, EC 1.1.1.284, FALDH, FDHGSNOR, formaldehyde dehydrogenase, Glutathione-dependent formaldehyde dehydrogenase, GSH-FDH, S-(hydroxymethyl)glutathione dehydrogenase
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: LIN37
Classification: Polyclonal
Dilution: Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:20 - 1:50, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:20 - 1:50
Gene Accession No.: Q96GY3
Gene Symbols: LIN37
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: PPGDACRSRIPSPLQPEMQGTPDDEPSEPEPSPSTLIYRNMQRWKRIRQRWKEASHRNQLRYSESMKILREMYERQ
Quantity: 0.1 mL
Research Discipline: __
Gene ID (Entrez): 55957
Target Species: Human
Isotype: IgG
Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: antolefinin, F25965, lin-37, lin-37 homolog (C. elegans), MGC9505, protein F25965, protein lin-37 homolog, ZK418.4
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: TEX30
Classification: Polyclonal
Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500
Gene Accession No.: Q5JUR7
Gene Symbols: TEX30
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: LGGRSMGSRAAASVMCHIEPDDGDDFVRGLICISYPLHHPKQQHKLRDEDLFRLKEPVLFVSGSADEMCEKNLLEKVAQKMQAP
Quantity: 0.1 mL
Research Discipline: __
Gene ID (Entrez): 93081
Target Species: Human
Isotype: IgG
Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: C13orf27, chromosome 13 open reading frame 27, hypothetical protein LOC93081, RP11-484I6.3, testis expressed 30
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
