TAF1L Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP230752-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP230752 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
TAF1L
Classification
Polyclonal
Dilution
Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000
Gene Accession No.
Q8IZX4
Gene Symbols
TAF1L
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: PKQPFMLQHASGEHKDGHGK
Quantity
0.1 mL
Research Discipline
Protein Kinase
Gene ID (Entrez)
138474
Target Species
Human
Isotype
IgG
Applications
Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Formulation
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias
210kDa, 210kDa-like, EC 2.7.11, EC 2.7.11.1, MGC134910, TAF(II)210, TAF1 RNA polymerase II, TATA box binding protein (TBP)-associated factor, TAF1-like RNA polymerase II, TATA box binding protein (TBP)-associated factor, TAF2A2, TBP-associated factor 1-like, TBP-associated factor 210 kDa, TBP-associated factor RNA polymerase 1-like, Transcription initiation factor TFIID 210 kDa subunit, transcription initiation factor TFIID subunit 1-like
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Related Products
Description
- TAF1L Polyclonal specifically detects TAF1L in Human samples
- It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: TAF1L
Classification: Polyclonal
Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000
Gene Accession No.: Q8IZX4
Gene Symbols: TAF1L
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: PKQPFMLQHASGEHKDGHGK
Quantity: 0.1 mL
Research Discipline: Protein Kinase
Gene ID (Entrez): 138474
Target Species: Human
Isotype: IgG
Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: 210kDa, 210kDa-like, EC 2.7.11, EC 2.7.11.1, MGC134910, TAF(II)210, TAF1 RNA polymerase II, TATA box binding protein (TBP)-associated factor, TAF1-like RNA polymerase II, TATA box binding protein (TBP)-associated factor, TAF2A2, TBP-associated factor 1-like, TBP-associated factor 210 kDa, TBP-associated factor RNA polymerase 1-like, Transcription initiation factor TFIID 210 kDa subunit, transcription initiation factor TFIID subunit 1-like
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: MBD3L1
Classification: Polyclonal
Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
Gene Accession No.: Q8WWY6
Gene Symbols: MBD3L1
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: ELSSTLDLANTLQKLVPSYTGGSLLEDLASGLEHSCPMPHLACSSDAVEIIPAEGVGISQLLCKQFLVTEE
Quantity: 0.1 mL
Research Discipline: __
Gene ID (Entrez): 85509
Target Species: Human
Isotype: IgG
Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: MBD3L, MBD3-like protein 1, methyl-CpG binding domain protein 3-like, methyl-CpG binding domain protein 3-like 1, methyl-CpG-binding domain protein 3-like 1, MGC138263, MGC138269
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: __
Classification: __
Dilution: __
Gene Accession No.: __
Gene Symbols: __
Immunogen: ELSSTLDLANTLQKLVPSYTGGSLLEDLASGLEHSCPMPHLACSSDAVEIIPAEGVGISQLLCKQFLVTEE
Quantity: 0.1mL
Research Discipline: __
Gene ID (Entrez): 85509
Target Species: __
Isotype: __
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: __
Host Species: __
Purification Method: Chromatography
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.