EME2 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP230885-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP230885 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
EME2
Classification
Polyclonal
Dilution
Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
Gene Accession No.
A4GXA9
Gene Symbols
EME2
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: ALAQYPLKQYRESQAFSFCTAGRWAAGEPVARDGAGLQAAWRRQIRQFSRVS
Quantity
0.1 mL
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Formulation
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias
EC 3.1.22, Essential Meiotic Endonuclease 1 Homolog 2, Essential Meiotic Endonuclease 1 Homolog 2 (S. Pombe), Essential Meiotic Structure-Specific Endonuclease Subunit 2, gs125, Homolog Of Yeast EME1 Endonuclease 2, Probable Crossover Junction Endonuclease EME2, SLX2 Structure-Specific Endonuclease Subunit Homolog B, SLX2 Structure-Specific Endonuclease Subunit Homolog B (S. Cerevisiae), SLX2B
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Gene ID (Entrez)
197342
Target Species
Human
Isotype
IgG
Related Products
Description
- EME2 Polyclonal specifically detects EME2 in Human samples
- It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: EME2
Classification: Polyclonal
Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
Gene Accession No.: A4GXA9
Gene Symbols: EME2
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: ALAQYPLKQYRESQAFSFCTAGRWAAGEPVARDGAGLQAAWRRQIRQFSRVS
Quantity: 0.1 mL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: EC 3.1.22, Essential Meiotic Endonuclease 1 Homolog 2, Essential Meiotic Endonuclease 1 Homolog 2 (S. Pombe), Essential Meiotic Structure-Specific Endonuclease Subunit 2, gs125, Homolog Of Yeast EME1 Endonuclease 2, Probable Crossover Junction Endonuclease EME2, SLX2 Structure-Specific Endonuclease Subunit Homolog B, SLX2 Structure-Specific Endonuclease Subunit Homolog B (S. Cerevisiae), SLX2B
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 197342
Target Species: Human
Isotype: IgG
Antigen: __
Classification: __
Dilution: __
Gene Accession No.: __
Gene Symbols: __
Immunogen: ALAQYPLKQYRESQAFSFCTAGRWAAGEPVARDGAGLQAAWRRQIRQFSRVS
Quantity: 0.1mL
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: __
Host Species: __
Purification Method: Chromatography
Regulatory Status: RUO
Gene ID (Entrez): 197342
Target Species: __
Isotype: __
Antigen: CDGSH Iron Sulfur Domain 3
Classification: Polyclonal
Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
Gene Accession No.: P0C7P0
Gene Symbols: CISD3
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: GARDLNPRRDISSWLAQWFPRTPARSVVALKTPIKVELVAGKTYRWCVCGRSKKQ
Quantity: 0.1 mL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: CDGSH Iron Sulfur Domain-Containing Protein 3, Mitochondrial, CDGSH Iron-Sulfur Domain-Containing Protein 3, Mitochondrial, CISD3, Miner2, MitoNEET Related 2, MitoNEET-Related Protein 2
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 284106
Target Species: Human
Isotype: IgG
