GRID2 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP231723-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP231723 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
GRID2
Classification
Polyclonal
Dilution
Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
Gene Accession No.
O43424
Gene Symbols
GRID2
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: AVYEHVRMKGLNPFERDSMYSQMWRMINRSNGSENNVLESQAGIQKVKYGNYAFVWDAAVLEYVAINDPDCSFYTIGNTVADR
Quantity
0.1 mL
Research Discipline
Neuronal Cell Markers, Neurotransmission
Gene ID (Entrez)
2895
Target Species
Human
Isotype
IgG
Applications
Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Formulation
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias
B230104L07Rik, cpr, creeper, gluR delta-2 subunit, GluRdelta2, glutamate receptor delta-2 subunit, glutamate receptor, ionotropic, delta 2, ho, hotfoot, Lc, lurcher, minisatellite 10ac detected by probe MMS10, MMS10-AC, Ms10ac, nmf408, tpr
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Related Products
Description
- Description GRID2 Polyclonal specifically detects GRID2 in Human samples
- It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: GRID2
Classification: Polyclonal
Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
Gene Accession No.: O43424
Gene Symbols: GRID2
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: AVYEHVRMKGLNPFERDSMYSQMWRMINRSNGSENNVLESQAGIQKVKYGNYAFVWDAAVLEYVAINDPDCSFYTIGNTVADR
Quantity: 0.1 mL
Research Discipline: Neuronal Cell Markers, Neurotransmission
Gene ID (Entrez): 2895
Target Species: Human
Isotype: IgG
Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: B230104L07Rik, cpr, creeper, gluR delta-2 subunit, GluRdelta2, glutamate receptor delta-2 subunit, glutamate receptor, ionotropic, delta 2, ho, hotfoot, Lc, lurcher, minisatellite 10ac detected by probe MMS10, MMS10-AC, Ms10ac, nmf408, tpr
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: __
Classification: __
Dilution: __
Gene Accession No.: __
Gene Symbols: __
Immunogen: TALRERKWGVQDVNQDNYIDAFECMVCTKVWANIRLQEKGLPPKRWEAEDTHLSCPEPTVFAFSPLRTPP
Quantity: 0.1mL
Research Discipline: __
Gene ID (Entrez): 84750
Target Species: __
Isotype: __
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: __
Host Species: __
Purification Method: Chromatography
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
Antigen: PTPLAD2
Classification: Polyclonal
Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50
Gene Accession No.: Q5VWC8
Gene Symbols: PTPLAD2
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: MGPLALPAWLQPRYRKNAYLF
Quantity: 0.1 mL
Research Discipline: __
Gene ID (Entrez): 401494
Target Species: Human
Isotype: IgG
Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: DKFZp686F01145, DKFZp686G24132, EC 4.2.1.-, Em:AL662879.1, HACD4, protein tyrosine phosphatase-like A domain containing 2, Protein tyrosine phosphatase-like protein PTPLAD2,3-hydroxyacyl-CoA dehydratase 4, Protein-tyrosine phosphatase-like A domain-containing protein 2
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.