RIMS4 Antibody, Novus Biologicals™
Manufacturer: Novus Biologicals
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP231842-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP231842 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
RIMS4
Classification
Polyclonal
Dilution
Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Gene Accession No.
Q9H426
Gene Symbols
RIMS4
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: TSSMVDPATGPLLRQASQLSLESTVGPCGE
Quantity
0.1 mL
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Formulation
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias
C20orf190, chromosome 20 open reading frame 190, dJ781B1.3, Rab3-interacting molecule 4, regulating synaptic membrane exocytosis 4, regulating synaptic membrane exocytosis protein 4, RIM 4, RIM4, RIM4 gamma, RIM4gamma
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Gene ID (Entrez)
140730
Target Species
Human
Isotype
IgG
Related Products
Description
- RIMS4 Polyclonal specifically detects RIMS4 in Human samples
- It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: RIMS4
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Gene Accession No.: Q9H426
Gene Symbols: RIMS4
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: TSSMVDPATGPLLRQASQLSLESTVGPCGE
Quantity: 0.1 mL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: C20orf190, chromosome 20 open reading frame 190, dJ781B1.3, Rab3-interacting molecule 4, regulating synaptic membrane exocytosis 4, regulating synaptic membrane exocytosis protein 4, RIM 4, RIM4, RIM4 gamma, RIM4gamma
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 140730
Target Species: Human
Isotype: IgG
Antigen: __
Classification: __
Dilution: __
Gene Accession No.: __
Gene Symbols: __
Immunogen: TSSMVDPATGPLLRQASQLSLESTVGPCGE
Quantity: 0.1mL
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: __
Host Species: __
Purification Method: Chromatography
Regulatory Status: RUO
Gene ID (Entrez): 140730
Target Species: __
Isotype: __
Antigen: NRSN1
Classification: Polyclonal
Dilution: Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200
Gene Accession No.: Q8IZ57
Gene Symbols: NRSN1
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: VKSYSKEEKFLQQKFKERIADIKAHTQPVTKAPGPGETKIPVTLSRVQNVQPLLAT
Quantity: 0.1 mL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: neurensin 1, neurensin-1, Neuro-p24, p24, vesicular membrain protein p24, Vesicular membrane protein of 24 kDa, Vesicular membrane protein p24neuro-p24, VMP
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 140767
Target Species: Human
Isotype: IgG