GTF3C6 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP231851-Each-of-1 | In Stock | ₹ 55,271.76 |
NBP231851 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 55,271.76
GST (18%): ₹ 9,948.917
Total Price: ₹ 65,220.677
Antigen
GTF3C6
Classification
Polyclonal
Dilution
Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:500 - 1:1000
Gene Accession No.
Q969F1
Gene Symbols
GTF3C6
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: DKSLELEEEEIQMNDSSNLSCEQEKPMHLEIEDSGPLIDIPSETEGSVFMETQMLP
Quantity
0.1 mL
Research Discipline
DNA replication Transcription Translation and Splicing
Gene ID (Entrez)
112495
Target Species
Human
Isotype
IgG
Applications
Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Formulation
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias
bA397G5.3, C6orf51chromosome 6 open reading frame 51, general transcription factor 3C polypeptide 6, general transcription factor IIIC, polypeptide 6, alpha 35kDa, TFIIIC35TFIIIC 35 kDa subunit, Transcription factor IIIC 35 kDa subunit, transcription factor IIIC 35kDa, Transcription factor IIIC subunit 6
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Related Products
Description
- Description GTF3C6 Polyclonal specifically detects GTF3C6 in Human samples
- It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: GTF3C6
Classification: Polyclonal
Dilution: Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:500 - 1:1000
Gene Accession No.: Q969F1
Gene Symbols: GTF3C6
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: DKSLELEEEEIQMNDSSNLSCEQEKPMHLEIEDSGPLIDIPSETEGSVFMETQMLP
Quantity: 0.1 mL
Research Discipline: DNA replication Transcription Translation and Splicing
Gene ID (Entrez): 112495
Target Species: Human
Isotype: IgG
Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: bA397G5.3, C6orf51chromosome 6 open reading frame 51, general transcription factor 3C polypeptide 6, general transcription factor IIIC, polypeptide 6, alpha 35kDa, TFIIIC35TFIIIC 35 kDa subunit, Transcription factor IIIC 35 kDa subunit, transcription factor IIIC 35kDa, Transcription factor IIIC subunit 6
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: __
Classification: __
Dilution: __
Gene Accession No.: __
Gene Symbols: __
Immunogen: DKSLELEEEEIQMNDSSNLSCEQEKPMHLEIEDSGPLIDIPSETEGSVFMETQMLP
Quantity: 0.1mL
Research Discipline: __
Gene ID (Entrez): 112495
Target Species: __
Isotype: __
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: __
Host Species: __
Purification Method: Chromatography
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
Antigen: Cystatin D/Cst5
Classification: Polyclonal
Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
Gene Accession No.: P28325
Gene Symbols: CST5
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: INEVPWEDKISILNYKCRKV
Quantity: 0.1 mL
Research Discipline: Proteases & Other Enzymes
Gene ID (Entrez): 1473
Target Species: Human
Isotype: IgG
Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: cystatin 5, cystatin D, Cystatin-5, cystatin-D, cysteine-proteinase inhibitor, MGC71922
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.