SLC37A4 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP231972-Each-of-1 | In Stock | ₹ 55,271.76 |
NBP231972 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 55,271.76
GST (18%): ₹ 9,948.917
Total Price: ₹ 65,220.677
Antigen
SLC37A4
Classification
Polyclonal
Dilution
Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200
Gene Accession No.
None
Gene Symbols
SLC37A4
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: LDKDDLGFITSSQSAAYAISKFVSGVLSDQMS
Quantity
0.1 mL
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Formulation
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias
G6PT, G6PT1G6PT3, G6PT2, Glucose-5-phosphate transporter, glucose-6-phosphatase, transport (glucose) protein 3, glucose-6-phosphatase, transport (glucose-6-phosphate) protein 1, glucose-6-phosphatase, transport (phosphate/pyrophosphate) protein 2, glucose-6-phosphate translocase, GSD1b, GSD1c, GSD1d, MGC15729, microsomal glucose-6-phosphate transporter, solute carrier family 37 (glucose-6-phosphate transporter), member 4, Solute carrier family 37 member 4, Transformation-related gene 19 protein, TRG19, TRG-19
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Gene ID (Entrez)
2542
Target Species
Human
Isotype
IgG
Related Products
Description
- SLC37A4 Polyclonal specifically detects SLC37A4 in Human samples
- It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: SLC37A4
Classification: Polyclonal
Dilution: Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200
Gene Accession No.: None
Gene Symbols: SLC37A4
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: LDKDDLGFITSSQSAAYAISKFVSGVLSDQMS
Quantity: 0.1 mL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: G6PT, G6PT1G6PT3, G6PT2, Glucose-5-phosphate transporter, glucose-6-phosphatase, transport (glucose) protein 3, glucose-6-phosphatase, transport (glucose-6-phosphate) protein 1, glucose-6-phosphatase, transport (phosphate/pyrophosphate) protein 2, glucose-6-phosphate translocase, GSD1b, GSD1c, GSD1d, MGC15729, microsomal glucose-6-phosphate transporter, solute carrier family 37 (glucose-6-phosphate transporter), member 4, Solute carrier family 37 member 4, Transformation-related gene 19 protein, TRG19, TRG-19
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 2542
Target Species: Human
Isotype: IgG
Antigen: __
Classification: __
Dilution: __
Gene Accession No.: __
Gene Symbols: __
Immunogen: LDKDDLGFITSSQSAAYAISKFVSGVLSDQMS
Quantity: 0.1mL
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: __
Host Species: __
Purification Method: Chromatography
Regulatory Status: RUO
Gene ID (Entrez): 2542
Target Species: __
Isotype: __
Antigen: SLC37A4
Classification: Polyclonal
Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500
Gene Accession No.: None
Gene Symbols: SLC37A4
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: NEPADVGLRNLDPMPSEGKKGSLKEESTLQE
Quantity: 0.1 mL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: G6PT, G6PT1G6PT3, G6PT2, Glucose-5-phosphate transporter, glucose-6-phosphatase, transport (glucose) protein 3, glucose-6-phosphatase, transport (glucose-6-phosphate) protein 1, glucose-6-phosphatase, transport (phosphate/pyrophosphate) protein 2, glucose-6-phosphate translocase, GSD1b, GSD1c, GSD1d, MGC15729, microsomal glucose-6-phosphate transporter, solute carrier family 37 (glucose-6-phosphate transporter), member 4, Solute carrier family 37 member 4, Transformation-related gene 19 protein, TRG19, TRG-19
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 2542
Target Species: Human
Isotype: IgG