CDKL1 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP232482-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP232482 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
CDKL1
Classification
Polyclonal
Dilution
Western Blot 0.4 ug/ml, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500
Gene Alias
CDC2-related kinase 1, cyclin-dependent kinase-like 1, cyclin-dependent kinase-like 1 (CDC2-related kinase), EC 2.7.11, EC 2.7.11.22, KKIALRE, P42, Protein kinase p42 KKIALRE, serine/threonine protein kinase KKIALRE, Serine/threonine-protein kinase KKIALRE
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Formulation
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols
CDKL1
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: RHQQVFSTNQYFSGVKIPDPEDMEPLELKFPNISYPALGLLK
Quantity
0.1 mL
Research Discipline
Cell Cycle and Replication
Gene ID (Entrez)
8814
Target Species
Human
Isotype
IgG
Related Products
Description
- CDKL1 Polyclonal specifically detects CDKL1 in Human samples
- It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: CDKL1
Classification: Polyclonal
Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500
Gene Alias: CDC2-related kinase 1, cyclin-dependent kinase-like 1, cyclin-dependent kinase-like 1 (CDC2-related kinase), EC 2.7.11, EC 2.7.11.22, KKIALRE, P42, Protein kinase p42 KKIALRE, serine/threonine protein kinase KKIALRE, Serine/threonine-protein kinase KKIALRE
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols: CDKL1
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: RHQQVFSTNQYFSGVKIPDPEDMEPLELKFPNISYPALGLLK
Quantity: 0.1 mL
Research Discipline: Cell Cycle and Replication
Gene ID (Entrez): 8814
Target Species: Human
Isotype: IgG
Antigen: TLR7
Classification: Polyclonal
Dilution: Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin
Gene Alias: toll-like receptor 7
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols: TLR7
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: MLNFTKNLKVLQKLMMNDNDISSSTSRTMESESLRTLEFRGNHLDVLWREGDNRYLQLFKNLLKLEELDISKNSLSFLPSGVFDGMPPNLKNL
Quantity: 0.1 mL
Research Discipline: Cytokine Research, Immunology, Innate Immunity, Toll Like Receptors
Gene ID (Entrez): 51284
Target Species: Human
Isotype: IgG
Antigen: __
Classification: __
Dilution: __
Gene Alias: __
Host Species: __
Purification Method: Chromatography
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: DLVLGLGALRRRKRLLEQEKSLAG
Quantity: 0.1mL
Research Discipline: __
Gene ID (Entrez): 3783
Target Species: __
Isotype: __