CD3 gamma Antibody, Novus Biologicals™
Manufacturer: Novus Biologicals
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP232636-Each-of-1 | In Stock | ₹ 55,271.76 |
NBP232636 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 55,271.76
GST (18%): ₹ 9,948.917
Total Price: ₹ 65,220.677
Antigen
CD3 gamma
Classification
Polyclonal
Dilution
Western Blot 0.4 ug/ml, Simple Western 1:25, Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500
Gene Alias
CD3g antigen, CD3g antigen, gamma polypeptide (TiT3 complex), CD3g molecule, epsilon (CD3-TCR complex), CD3g molecule, gamma (CD3-TCR complex), CD3-GAMMA, FLJ17620, FLJ17664, FLJ79544, FLJ94613, MGC138597, T3G, T-cell antigen receptor complex, gamma subunit of T3, T-cell receptor T3 gamma chain, T-cell surface glycoprotein CD3 gamma chain
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Formulation
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols
CD3G
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: GQDGVRQSRASDKQTLLPNDQLYQPLKDREDDQYSHLQGNQLRRN
Quantity
0.1 mL
Research Discipline
Apoptosis, Innate Immunity
Gene ID (Entrez)
917
Target Species
Human
Isotype
IgG
Related Products
Description
- CD3 gamma Polyclonal specifically detects CD3 gamma in Human samples
- It is validated for Western Blot, Simple Western, Immunohistochemistry, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: CD3 gamma
Classification: Polyclonal
Dilution: Western Blot 0.4 ug/ml, Simple Western 1:25, Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500
Gene Alias: CD3g antigen, CD3g antigen, gamma polypeptide (TiT3 complex), CD3g molecule, epsilon (CD3-TCR complex), CD3g molecule, gamma (CD3-TCR complex), CD3-GAMMA, FLJ17620, FLJ17664, FLJ79544, FLJ94613, MGC138597, T3G, T-cell antigen receptor complex, gamma subunit of T3, T-cell receptor T3 gamma chain, T-cell surface glycoprotein CD3 gamma chain
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols: CD3G
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: GQDGVRQSRASDKQTLLPNDQLYQPLKDREDDQYSHLQGNQLRRN
Quantity: 0.1 mL
Research Discipline: Apoptosis, Innate Immunity
Gene ID (Entrez): 917
Target Species: Human
Isotype: IgG
Antigen: __
Classification: __
Dilution: __
Gene Alias: __
Host Species: __
Purification Method: Chromatography
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: GQDGVRQSRASDKQTLLPNDQLYQPLKDREDDQYSHLQGNQLRRN
Quantity: 0.1mL
Research Discipline: __
Gene ID (Entrez): 916
Target Species: __
Isotype: __
Antigen: KANSL2
Classification: Polyclonal
Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:500 - 1:1000
Gene Alias: C12orf41, chromosome 12 open reading frame 41, FLJ12670, FLJ20436, hypothetical protein LOC54934, KANSL2, KAT8 regulatory NSL complex subunit 2, NSL2
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols: KANSL2
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: FSDDLDVVGDGMQCPPSPLLFDPSLTLEDHLVKEIAEDPVDILGQMQMAGDGCRSQGSRNSEKASAPLSQSGLATANGKPEP
Quantity: 0.1 mL
Research Discipline: __
Gene ID (Entrez): 54934
Target Species: Human
Isotype: IgG