SMC6L1 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP233378-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP233378 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
SMC6L1
Classification
Polyclonal
Dilution
Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200
Gene Accession No.
Q96SB8
Gene Symbols
SMC6
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: KEEHGKIKREELDVKHALSYNQRQLKELKDSKTDRLKRFGPNVPALLEAIDDAYRQGHFTYKPVGPLGACIHLRDPELALAIESCL
Quantity
0.1 mL
Research Discipline
Cell Cycle and Replication, DNA Repair
Gene ID (Entrez)
79677
Target Species
Human
Isotype
IgG
Applications
Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Formulation
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias
FLJ22116, hSMC6, SMC protein 6, SMC-6, SMC6 structural maintenance of chromosomes 6-like 1, SMC6 structural maintenance of chromosomes 6-like 1 (yeast), SMC6L1FLJ35534, structural maintenance of chromosomes 6, structural maintenance of chromosomes protein 6
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Related Products
Description
- SMC6L1 Polyclonal specifically detects SMC6L1 in Human samples
- It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: SMC6L1
Classification: Polyclonal
Dilution: Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200
Gene Accession No.: Q96SB8
Gene Symbols: SMC6
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: KEEHGKIKREELDVKHALSYNQRQLKELKDSKTDRLKRFGPNVPALLEAIDDAYRQGHFTYKPVGPLGACIHLRDPELALAIESCL
Quantity: 0.1 mL
Research Discipline: Cell Cycle and Replication, DNA Repair
Gene ID (Entrez): 79677
Target Species: Human
Isotype: IgG
Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: FLJ22116, hSMC6, SMC protein 6, SMC-6, SMC6 structural maintenance of chromosomes 6-like 1, SMC6 structural maintenance of chromosomes 6-like 1 (yeast), SMC6L1FLJ35534, structural maintenance of chromosomes 6, structural maintenance of chromosomes protein 6
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: __
Classification: __
Dilution: __
Gene Accession No.: __
Gene Symbols: __
Immunogen: KEEHGKIKREELDVKHALSYNQRQLKELKDSKTDRLKRFGPNVPALLEAIDDAYRQGHFTYKPVGPLGACIHLRDPELALAIESCL
Quantity: 0.1mL
Research Discipline: __
Gene ID (Entrez): 79677
Target Species: __
Isotype: __
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: __
Host Species: __
Purification Method: Chromatography
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
Antigen: PPP2R2D
Classification: Polyclonal
Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
Gene Accession No.: Q66LE6
Gene Symbols: PPP2R2D
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: FEEPEDPSSRSFFSEIISSISDVKFSHSGRYM
Quantity: 0.1 mL
Research Discipline: Protein Phosphatase
Gene ID (Entrez): 55844
Target Species: Human
Isotype: IgG
Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: KIAA1541, MDS026, PP2A subunit B isoform B55-delta, PP2A subunit B isoform delta, PP2A subunit B isoform PR55-delta, PP2A subunit B isoform R2-delta, protein phosphatase 2, regulatory subunit B, delta, protein phosphatase 2, regulatory subunit B, delta isoform, serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B deltaisoform
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.