Phosphodiesterase 4A/PDE4A Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP233388-Each-of-1 | In Stock | ₹ 55,271.76 |
NBP233388 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 55,271.76
GST (18%): ₹ 9,948.917
Total Price: ₹ 65,220.677
Antigen
Phosphodiesterase 4A/PDE4A
Classification
Polyclonal
Dilution
Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000
Gene Accession No.
P27815
Gene Symbols
PDE4A
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: EAVYLTQQAQSTGSAPVAPDEFSSREEFVVAVSHSSPSALALQSPLLPAWRTLSVSEHA
Quantity
0.1 mL
Research Discipline
Apoptosis, Signal Transduction, Stem Cell Markers
Gene ID (Entrez)
5141
Target Species
Human
Isotype
IgG
Applications
Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Formulation
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias
cAMP-specific 3'-5'-cyclic phosphodiesterase 4A, DPDE2cAMP-specific phosphodiesterase, EC 3.1.4, EC 3.1.4.17, PDE4, PDE46, phosphodiesterase 4A, cAMP-specific, phosphodiesterase 4A, cAMP-specific (dunce, phosphodiesterase 4A, cAMP-specific (dunce (Drosophila)-homologphosphodiesterase E2), phosphodiesterase E2 dunce homolog, Drosophila, phosphodiesterase isozyme 4
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Related Products
Description
- Phosphodiesterase 4A/PDE4A Polyclonal specifically detects Phosphodiesterase 4A/PDE4A in Human samples
- It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: Phosphodiesterase 4A/PDE4A
Classification: Polyclonal
Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000
Gene Accession No.: P27815
Gene Symbols: PDE4A
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: EAVYLTQQAQSTGSAPVAPDEFSSREEFVVAVSHSSPSALALQSPLLPAWRTLSVSEHA
Quantity: 0.1 mL
Research Discipline: Apoptosis, Signal Transduction, Stem Cell Markers
Gene ID (Entrez): 5141
Target Species: Human
Isotype: IgG
Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: cAMP-specific 3'-5'-cyclic phosphodiesterase 4A, DPDE2cAMP-specific phosphodiesterase, EC 3.1.4, EC 3.1.4.17, PDE4, PDE46, phosphodiesterase 4A, cAMP-specific, phosphodiesterase 4A, cAMP-specific (dunce, phosphodiesterase 4A, cAMP-specific (dunce (Drosophila)-homologphosphodiesterase E2), phosphodiesterase E2 dunce homolog, Drosophila, phosphodiesterase isozyme 4
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: __
Classification: __
Dilution: __
Gene Accession No.: __
Gene Symbols: __
Immunogen: EAVYLTQQAQSTGSAPVAPDEFSSREEFVVAVSHSSPSALALQSPLLPAWRTLSVSEHA
Quantity: 0.1mL
Research Discipline: __
Gene ID (Entrez): 5141
Target Species: __
Isotype: __
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: __
Host Species: __
Purification Method: Chromatography
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
Antigen: Uroplakin II
Classification: Polyclonal
Dilution: Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
Gene Accession No.: O00526
Gene Symbols: UPK2
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: ISSLSGLLSPALTESLLVALPPCHLTGGNATLMVRRANDSKVVTSSFVVPPCRGRRELVS
Quantity: 0.1 mL
Research Discipline: __
Gene ID (Entrez): 7379
Target Species: Human
Isotype: IgG
Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: UP2, UPII, UPK2 uroplakin 2
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.