MDH1 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP233708-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP233708 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
MDH1
Classification
Polyclonal
Dilution
Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000
Gene Accession No.
P40925
Gene Symbols
MDH1
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: DHVRDIWFGTPEGEFVSMGVISDGNSYGVPDDLLYSFPVVIKNKTWKFVEGLPINDFSREKMDLTAKELTEEKESAFEFLSS
Quantity
0.1 mL
Research Discipline
Cancer, Immunology, Stem Cell Markers, Virology Bacteria and Parasites
Gene ID (Entrez)
4190
Target Species
Human
Isotype
IgG
Applications
Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Formulation
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias
cytoplasmic, Cytosolic malate dehydrogenase, malate dehydrogenase 1, NAD (soluble), MDHA, MDH-s, MGC:1375, MOR2, soluble malate dehydrogenase
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Related Products
Description
- Description MDH1 Polyclonal specifically detects MDH1 in Human samples
- It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: MDH1
Classification: Polyclonal
Dilution: Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000
Gene Accession No.: P40925
Gene Symbols: MDH1
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: DHVRDIWFGTPEGEFVSMGVISDGNSYGVPDDLLYSFPVVIKNKTWKFVEGLPINDFSREKMDLTAKELTEEKESAFEFLSS
Quantity: 0.1 mL
Research Discipline: Cancer, Immunology, Stem Cell Markers, Virology Bacteria and Parasites
Gene ID (Entrez): 4190
Target Species: Human
Isotype: IgG
Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: cytoplasmic, Cytosolic malate dehydrogenase, malate dehydrogenase 1, NAD (soluble), MDHA, MDH-s, MGC:1375, MOR2, soluble malate dehydrogenase
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: __
Classification: __
Dilution: __
Gene Accession No.: __
Gene Symbols: __
Immunogen: DHVRDIWFGTPEGEFVSMGVISDGNSYGVPDDLLYSFPVVIKNKTWKFVEGLPINDFSREKMDLTAKELTEEKESAFEFLSS
Quantity: 0.1mL
Research Discipline: __
Gene ID (Entrez): 4190
Target Species: __
Isotype: __
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: __
Host Species: __
Purification Method: Chromatography
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
Antigen: MYSM1
Classification: Polyclonal
Dilution: Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500
Gene Accession No.: Q5VVJ2
Gene Symbols: MYSM1
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: KQDETLSSSEITLWTEKQSNGDKKSIELNDQKFNELIKNCNKHDGRGIIVDARQLPSPEPCEIQKNLNDNEMLFHSCQMVEESHEEEELK
Quantity: 0.1 mL
Research Discipline: __
Gene ID (Entrez): 114803
Target Species: Human
Isotype: IgG
Applications: Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: DKFZp779J1554, DKFZp779J1721,2A-DUB, histone H2A deubiquitinase MYSM1, KIAA1915, Myb-like, SWIRM and MPN domains 1,2ADUB, RP4-592A1.1, SWIRM and MPN domain-containing protein 1
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.