Uromodulin Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP233393-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP233393 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
Uromodulin
Classification
Polyclonal
Dilution
Western Blot 0.04 - 0.4 ug/ml, Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500
Gene Accession No.
P07911
Gene Symbols
UMOD
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: GYYVYNLTAPPECHLAYCTDPSSVEGTCEECSIDEDCKSNNGRWHCQCKQDFNITDISLLEHRLECGANDMKVSLGK
Quantity
0.1 mL
Research Discipline
Cell Cycle and Replication
Gene ID (Entrez)
7369
Target Species
Human
Isotype
IgG
Applications
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Formulation
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias
ADMCKD2, FJHN, HNFJ, HNFJ1, MCKD2, Tamm-Horsfall glycoprotein, Tamm-Horsfall urinary glycoprotein, THGP, THP, uromodulin, uromodulin (uromucoid, Tamm-Horsfall glycoprotein), uromucoid
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Related Products
Description
- Uromodulin Polyclonal specifically detects Uromodulin in Human samples
- It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: Uromodulin
Classification: Polyclonal
Dilution: Western Blot 0.04 - 0.4 ug/ml, Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500
Gene Accession No.: P07911
Gene Symbols: UMOD
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: GYYVYNLTAPPECHLAYCTDPSSVEGTCEECSIDEDCKSNNGRWHCQCKQDFNITDISLLEHRLECGANDMKVSLGK
Quantity: 0.1 mL
Research Discipline: Cell Cycle and Replication
Gene ID (Entrez): 7369
Target Species: Human
Isotype: IgG
Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: ADMCKD2, FJHN, HNFJ, HNFJ1, MCKD2, Tamm-Horsfall glycoprotein, Tamm-Horsfall urinary glycoprotein, THGP, THP, uromodulin, uromodulin (uromucoid, Tamm-Horsfall glycoprotein), uromucoid
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: __
Classification: __
Dilution: __
Gene Accession No.: __
Gene Symbols: __
Immunogen: GYYVYNLTAPPECHLAYCTDPSSVEGTCEECSIDEDCKSNNGRWHCQCKQDFNITDISLLEHRLECGANDMKVSLGK
Quantity: 0.1mL
Research Discipline: __
Gene ID (Entrez): 7369
Target Species: __
Isotype: __
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: __
Host Species: __
Purification Method: Chromatography
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
Antigen: CSAP
Classification: Polyclonal
Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000
Gene Accession No.: Q6IQ19
Gene Symbols: CCSAP
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: EEQDAEAGDAEAEDAEDAALPALPVKDVEDKPEQQTRTRETDKSPTSTEPRQQPSALFARGNRKAVKSPQRSSSKIKENKHPFALYGW
Quantity: 0.1 mL
Research Discipline: __
Gene ID (Entrez): 126731
Target Species: Human
Isotype: IgG
Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: C1orf96, centriole, cilia and spindle-associated protein, chromosome 1 open reading frame 96, RP4-803J11.3
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.