SPTLC3 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP233418-Each-of-1 | In Stock | ₹ 55,271.76 |
NBP233418 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 55,271.76
GST (18%): ₹ 9,948.917
Total Price: ₹ 65,220.677
Antigen
SPTLC3
Classification
Polyclonal
Dilution
Western Blot 1:100 - 1:250, Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500
Gene Accession No.
Q9NUV7
Gene Symbols
SPTLC3
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: SYNFLGLAAKYDESMRTIKDVLEVYGTGVASTRHEMGTLDKHKELEDLVAKFLNVEAAMVF
Quantity
0.1 mL
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Formulation
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias
C20orf38, Chromosome 20 Open Reading Frame 38, dJ718P11, EC 2.3.1.50, hLCB2b, LCB 3, LCB2B, LCB3, Long Chain Base Biosynthesis Protein 2b, Long Chain Base Biosynthesis Protein 3, Serine Palmitoyltransferase 3, Serine Palmitoyltransferase, Long Chain Base Subunit 2-Like (Aminotransferase 2), Serine Palmitoyltransferase, Long Chain Base Subunit 3, Serine-Palmitoyl-CoA Transferase 3, SPT 3, SPT3, SPTLC2L
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Gene ID (Entrez)
55304
Target Species
Human
Isotype
IgG
Related Products
Description
- SPTLC3 Polyclonal specifically detects SPTLC3 in Human samples
- It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: SPTLC3
Classification: Polyclonal
Dilution: Western Blot 1:100 - 1:250, Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500
Gene Accession No.: Q9NUV7
Gene Symbols: SPTLC3
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: SYNFLGLAAKYDESMRTIKDVLEVYGTGVASTRHEMGTLDKHKELEDLVAKFLNVEAAMVF
Quantity: 0.1 mL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: C20orf38, Chromosome 20 Open Reading Frame 38, dJ718P11, EC 2.3.1.50, hLCB2b, LCB 3, LCB2B, LCB3, Long Chain Base Biosynthesis Protein 2b, Long Chain Base Biosynthesis Protein 3, Serine Palmitoyltransferase 3, Serine Palmitoyltransferase, Long Chain Base Subunit 2-Like (Aminotransferase 2), Serine Palmitoyltransferase, Long Chain Base Subunit 3, Serine-Palmitoyl-CoA Transferase 3, SPT 3, SPT3, SPTLC2L
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 55304
Target Species: Human
Isotype: IgG
Antigen: __
Classification: __
Dilution: __
Gene Accession No.: __
Gene Symbols: __
Immunogen: SYNFLGLAAKYDESMRTIKDVLEVYGTGVASTRHEMGTLDKHKELEDLVAKFLNVEAAMVF
Quantity: 0.1mL
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: __
Host Species: __
Purification Method: Chromatography
Regulatory Status: RUO
Gene ID (Entrez): 55304
Target Species: __
Isotype: __
Antigen: A1BG
Classification: Polyclonal
Dilution: Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
Gene Accession No.: P04217
Gene Symbols: A1BG
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: SESLLKPLANVTLTCQARLETPDFQLFKNGVAQEPVHLDSPAIKHQFLLTGDTQGRYRCRSGLSTGWTQLSKLLELTGPKSLPAPWLSM
Quantity: 0.1 mL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: A1B, ABG, alpha-1-B glycoproteinGAB, alpha-1B-glycoprotein, DKFZp686F0970, HYST2477
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 1
Target Species: Human
Isotype: IgG