Galectin-9 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP233484-Each-of-1 | In Stock | ₹ 55,271.76 |
NBP233484 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 55,271.76
GST (18%): ₹ 9,948.917
Total Price: ₹ 65,220.677
Antigen
Galectin-9
Classification
Polyclonal
Dilution
Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
Gene Accession No.
O00182
Gene Symbols
LGALS9
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: RFDENAVVRNTQIDNSWGSEERSLPRKMPFVRGQSFSVWILCEAHCLKVAVDGQHLFEYYHRLRNLPTIN
Quantity
0.1 mL
Research Discipline
Signal Transduction
Gene ID (Entrez)
3965
Target Species
Human
Isotype
IgG
Applications
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Formulation
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias
ecalectin, Gal-9, galectin 9, galectin-9, HUAT, lectin, galactoside-binding, soluble, 9, LGALS9A, MGC117375, MGC125973, MGC125974, Tumor antigen HOM-HD-21, urate transporter/channel protein
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Related Products
Description
- Description Galectin-9 Polyclonal specifically detects Galectin-9 in Human samples
- It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: Galectin-9
Classification: Polyclonal
Dilution: Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
Gene Accession No.: O00182
Gene Symbols: LGALS9
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: RFDENAVVRNTQIDNSWGSEERSLPRKMPFVRGQSFSVWILCEAHCLKVAVDGQHLFEYYHRLRNLPTIN
Quantity: 0.1 mL
Research Discipline: Signal Transduction
Gene ID (Entrez): 3965
Target Species: Human
Isotype: IgG
Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: ecalectin, Gal-9, galectin 9, galectin-9, HUAT, lectin, galactoside-binding, soluble, 9, LGALS9A, MGC117375, MGC125973, MGC125974, Tumor antigen HOM-HD-21, urate transporter/channel protein
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: __
Classification: __
Dilution: __
Gene Accession No.: __
Gene Symbols: __
Immunogen: RFDENAVVRNTQIDNSWGSEERSLPRKMPFVRGQSFSVWILCEAHCLKVAVDGQHLFEYYHRLRNLPTIN
Quantity: 0.1mL
Research Discipline: __
Gene ID (Entrez): 3965
Target Species: __
Isotype: __
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: __
Host Species: __
Purification Method: Chromatography
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
Antigen: Cytochrome P450 2A6
Classification: Polyclonal
Dilution: Simple Western 1:25, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
Gene Accession No.: P11509
Gene Symbols: CYP2A6
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: QEEAGFLIDALRGTGGANIDPTFFLSR
Quantity: 0.1 mL
Research Discipline: Lipid and Metabolism
Gene ID (Entrez): 1548
Target Species: Human
Isotype: IgG
Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: Coumarin 7-hydroxylase, CPA6, CYP2A3P450C2A, CYP2AEC 1.14.14.1, CYPIIA6, cytochrome P450 2A6, Cytochrome P450 IIA3, Cytochrome P450(I), cytochrome P450, family 2, subfamily A, polypeptide 6, cytochrome P450, subfamily IIA (phenobarbital-inducible), polypeptide 6, flavoprotein-linked monooxygenase, P450PB, xenobiotic monooxygenase
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.