ELOVL5 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP233500-Each-of-1 | In Stock | ₹ 55,271.76 |
NBP233500 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 55,271.76
GST (18%): ₹ 9,948.917
Total Price: ₹ 65,220.677
Antigen
ELOVL5
Classification
Polyclonal
Dilution
Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:2500 - 1:5000, Immunocytochemistry/Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:1000 - 1:2500
Gene Accession No.
Q9NYP7
Gene Symbols
ELOVL5
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: QTYNKKGASRRKDHLKDHQNGSMAAVNGHTNSFSPLENNVKPRKLRKD
Quantity
0.1 mL
Research Discipline
Cardiovascular Biology, Cellular Signaling
Gene ID (Entrez)
60481
Target Species
Human
Isotype
IgG
Applications
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Formulation
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias
dJ483K16.1, EC 2.3.1.n8, elongation of very long chain fatty acids protein 5, ELOVL family member 5, elongation of long chain fatty acids (FEN1/Elo2, ELOVL2,3-keto acyl-CoA synthase ELOVL5, Fatty acid elongase 1, hELO1, HELO1homolog of yeast long chain polyunsaturated fatty acid elongation enzyme 2, homolog of yeast long chain polyunsaturated fatty acid elongatio, SUR4/Elo3-like, yeast)
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Related Products
Description
- ELOVL5 Polyclonal specifically detects ELOVL5 in Human samples
- It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: ELOVL5
Classification: Polyclonal
Dilution: Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:2500 - 1:5000, Immunocytochemistry/Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:1000 - 1:2500
Gene Accession No.: Q9NYP7
Gene Symbols: ELOVL5
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: QTYNKKGASRRKDHLKDHQNGSMAAVNGHTNSFSPLENNVKPRKLRKD
Quantity: 0.1 mL
Research Discipline: Cardiovascular Biology, Cellular Signaling
Gene ID (Entrez): 60481
Target Species: Human
Isotype: IgG
Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: dJ483K16.1, EC 2.3.1.n8, elongation of very long chain fatty acids protein 5, ELOVL family member 5, elongation of long chain fatty acids (FEN1/Elo2, ELOVL2,3-keto acyl-CoA synthase ELOVL5, Fatty acid elongase 1, hELO1, HELO1homolog of yeast long chain polyunsaturated fatty acid elongation enzyme 2, homolog of yeast long chain polyunsaturated fatty acid elongatio, SUR4/Elo3-like, yeast)
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: __
Classification: __
Dilution: __
Gene Accession No.: __
Gene Symbols: __
Immunogen: DNCYDQAKKLDSCKFLLDNPYTHTYSYSCSGSAITCSSKNKECEAFICNCDRNAAICFSKAPYNKAHKNLDTKKYCQS
Quantity: 0.1mL
Research Discipline: __
Gene ID (Entrez): 5319
Target Species: __
Isotype: __
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: __
Host Species: __
Purification Method: Chromatography
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
Antigen: NCF1
Classification: Polyclonal
Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
Gene Accession No.: P14598
Gene Symbols: NCF1
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: YMFLVKWQDLSEKVVYRRFTEIYEFHKTLKEMFPIEAGAINPENRIIPHLPAPKWFDGQRAAENHQ
Quantity: 0.1 mL
Research Discipline: __
Gene ID (Entrez): 653361
Target Species: Human
Isotype: IgG
Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: 47 kDa neutrophil oxidase factor, FLJ79451, NADPH oxidase organizer 2, NCF-1, NCF1A, neutrophil cytosol factor 1,47 kDa autosomal chronic granulomatous disease protein, neutrophil cytosolic factor 1, neutrophil cytosolic factor 1 (47kD, chronic granulomatous disease, autosomal1), neutrophil cytosolic factor 1, (chronic granulomatous disease, autosomal 1), Neutrophil NADPH oxidase factor 1, Nox organizer 2, NOXO2NCF-47K, Nox-organizing protein 2, p47phox, SH3 and PX domain-containing protein 1A, SH3PXD1Ap47-phox
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.