BCL11B Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP233549-Each-of-1 | In Stock | ₹ 55,271.76 |
NBP233549 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 55,271.76
GST (18%): ₹ 9,948.917
Total Price: ₹ 65,220.677
Antigen
BCL11B
Classification
Polyclonal
Dilution
Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200
Gene Accession No.
Q9C0K0
Gene Symbols
BCL11B
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: QGNPQHLSQRELITPEADHVEAAILEEDEGLEIEEPSGLGLMVGGPDPDLLTCG
Quantity
0.1 mL
Research Discipline
Apoptosis, Cancer, Transcription Factors and Regulators, Tumor Suppressors
Gene ID (Entrez)
64919
Target Species
Human, Mouse
Isotype
IgG
Applications
Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Formulation
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias
B-cell CLL/lymphoma 11B, B-cell CLL/lymphoma 11B (zinc finger protein), B-cell CLL/lymphoma 11B/T-cell receptor delta constant region fusion protein, B-cell lymphoma/leukaemia 11B, B-cell lymphoma/leukemia 11B, BCL-11B, BCL11B/TRDC fusion, COUP-TF-interacting protein 2, CTIP-2, CTIP2ZNF856B, hRit1, hRIT1-alpha, Radiation-induced tumor suppressor gene 1 protein, RIT1, zinc finger protein hRit1 alpha
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Related Products
Description
- BCL11B Polyclonal specifically detects BCL11B in Human, Mouse samples
- It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: BCL11B
Classification: Polyclonal
Dilution: Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200
Gene Accession No.: Q9C0K0
Gene Symbols: BCL11B
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: QGNPQHLSQRELITPEADHVEAAILEEDEGLEIEEPSGLGLMVGGPDPDLLTCG
Quantity: 0.1 mL
Research Discipline: Apoptosis, Cancer, Transcription Factors and Regulators, Tumor Suppressors
Gene ID (Entrez): 64919
Target Species: Human, Mouse
Isotype: IgG
Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: B-cell CLL/lymphoma 11B, B-cell CLL/lymphoma 11B (zinc finger protein), B-cell CLL/lymphoma 11B/T-cell receptor delta constant region fusion protein, B-cell lymphoma/leukaemia 11B, B-cell lymphoma/leukemia 11B, BCL-11B, BCL11B/TRDC fusion, COUP-TF-interacting protein 2, CTIP-2, CTIP2ZNF856B, hRit1, hRIT1-alpha, Radiation-induced tumor suppressor gene 1 protein, RIT1, zinc finger protein hRit1 alpha
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: __
Classification: __
Dilution: __
Gene Accession No.: __
Gene Symbols: __
Immunogen: QGNPQHLSQRELITPEADHVEAAILEEDEGLEIEEPSGLGLMVGGPDPDLLTCG
Quantity: 0.1mL
Research Discipline: __
Gene ID (Entrez): 64919
Target Species: __
Isotype: __
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: __
Host Species: __
Purification Method: Chromatography
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
Antigen: FAM183A
Classification: Polyclonal
Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
Gene Accession No.: Q6ZVS7
Gene Symbols: FAM183A
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: PMSWHDNLEEPADARFLNLIHHAAQGPTKKYPE
Quantity: 0.1 mL
Research Discipline: __
Gene ID (Entrez): 440585
Target Species: Human
Isotype: IgG
Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: Family With Sequence Similarity 183 Member A, Family With Sequence Similarity 183, Member A, HCG23177, Protein FAM183A
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.