ARID3B Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP233596-Each-of-1 | In Stock | ₹ 55,271.76 |
NBP233596 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 55,271.76
GST (18%): ₹ 9,948.917
Total Price: ₹ 65,220.677
Antigen
ARID3B
Classification
Polyclonal
Dilution
Western Blot 0.4 ug/ml, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200
Gene Accession No.
Q8IVW6
Gene Symbols
ARID3B
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: GSSSGTNTSSPRISPATTLRKGDGAPVTTVPVPNRLAVPVTLASQQAGTRTAALEQLR
Quantity
0.1 mL
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Formulation
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias
ARID domain-containing protein 3B, AT rich interactive domain 3B (BRIGHT- like), AT rich interactive domain 3B (BRIGHT-like), AT-rich interactive domain-containing protein 3B, BDP, bright and dead ringer protein, DRIL2
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Gene ID (Entrez)
10620
Target Species
Human
Isotype
IgG
Related Products
Description
- ARID3B Polyclonal specifically detects ARID3B in Human samples
- It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: ARID3B
Classification: Polyclonal
Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200
Gene Accession No.: Q8IVW6
Gene Symbols: ARID3B
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: GSSSGTNTSSPRISPATTLRKGDGAPVTTVPVPNRLAVPVTLASQQAGTRTAALEQLR
Quantity: 0.1 mL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: ARID domain-containing protein 3B, AT rich interactive domain 3B (BRIGHT- like), AT rich interactive domain 3B (BRIGHT-like), AT-rich interactive domain-containing protein 3B, BDP, bright and dead ringer protein, DRIL2
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 10620
Target Species: Human
Isotype: IgG
Antigen: __
Classification: __
Dilution: __
Gene Accession No.: __
Gene Symbols: __
Immunogen: MEFRQEEFRKLAGRALGKLHRL
Quantity: 0.1mL
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: __
Host Species: __
Purification Method: Chromatography
Regulatory Status: RUO
Gene ID (Entrez): 57030
Target Species: __
Isotype: __
Antigen: PLAC1L
Classification: Polyclonal
Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500
Gene Accession No.: Q86WS3
Gene Symbols: PLAC1L
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: ISCSLDWLMVSVIPVAESRNLYIFADELHLGMGCPANRIHTYVYEFIYLVRDCGIRTRVVSEETLL
Quantity: 0.1 mL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: FLJ36198, placenta-specific 1-like, placenta-specific 1-like protein, TMEM122, transmembrane protein 122
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 219990
Target Species: Human
Isotype: IgG