Exosome component 5 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP233677-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP233677 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
Exosome component 5
Classification
Polyclonal
Dilution
Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
Gene Accession No.
Q9NQT4
Gene Symbols
EXOSC5
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: RALFCGVACALDSDGTLVLDPTSKQEKEARAVLTFALDSVERKLLMSSTKGLYSDTELQQCLAAAQAASQHVFRFYRESL
Quantity
0.1 mL
Research Discipline
DNA replication Transcription Translation and Splicing, Epigenetics
Gene ID (Entrez)
56915
Target Species
Human
Isotype
IgG
Applications
Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Formulation
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias
CML28, exosome complex exonuclease RRP46, exosome component 5Chronic myelogenous leukemia tumor antigen 28, exosome component Rrp46, hRrp46p, MGC12901, p12BMGC111224, RRP41B, Rrp46p, RRP46Ribosomal RNA-processing protein 46
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Related Products
Description
- Exosome component 5 Polyclonal specifically detects Exosome component 5 in Human samples
- It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: Exosome component 5
Classification: Polyclonal
Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
Gene Accession No.: Q9NQT4
Gene Symbols: EXOSC5
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: RALFCGVACALDSDGTLVLDPTSKQEKEARAVLTFALDSVERKLLMSSTKGLYSDTELQQCLAAAQAASQHVFRFYRESL
Quantity: 0.1 mL
Research Discipline: DNA replication Transcription Translation and Splicing, Epigenetics
Gene ID (Entrez): 56915
Target Species: Human
Isotype: IgG
Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: CML28, exosome complex exonuclease RRP46, exosome component 5Chronic myelogenous leukemia tumor antigen 28, exosome component Rrp46, hRrp46p, MGC12901, p12BMGC111224, RRP41B, Rrp46p, RRP46Ribosomal RNA-processing protein 46
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: __
Classification: __
Dilution: __
Gene Accession No.: __
Gene Symbols: __
Immunogen: RALFCGVACALDSDGTLVLDPTSKQEKEARAVLTFALDSVERKLLMSSTKGLYSDTELQQCLAAAQAASQHVFRFYRESL
Quantity: 0.1mL
Research Discipline: __
Gene ID (Entrez): 56915
Target Species: __
Isotype: __
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: __
Host Species: __
Purification Method: Chromatography
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
Antigen: Amylin
Classification: Polyclonal
Dilution: Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000
Gene Accession No.: P10997
Gene Symbols: IAPP
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: LVHSSNNFGAILSSTNVGSNTYGKRNAVEVLKREPLNYLP
Quantity: 0.1 mL
Research Discipline: Angiogenesis, Apoptosis, Cancer
Gene ID (Entrez): 3375
Target Species: Human
Isotype: IgG
Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: AMYLIN, DAPamylin, Diabetes-associated peptide, IAP, Insulinoma amyloid peptide, islet amyloid polypeptide, Islet amyloid polypeptide (diabetes-associated peptide; amylin)
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.