ST8 alpha-2,8-Sialyltransferase 8B/ST8SIA2 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP233719-Each-of-1 | In Stock | ₹ 55,271.76 |
NBP233719 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 55,271.76
GST (18%): ₹ 9,948.917
Total Price: ₹ 65,220.677
Antigen
ST8 alpha-2,8-Sialyltransferase 8B/ST8SIA2
Classification
Polyclonal
Dilution
Western Blot 0.4 ug/ml, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200
Gene Accession No.
Q92186
Gene Symbols
ST8SIA2
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: SVIQRAFEDLVNATWREKLLQRLHSLNGSILWIPAFMARGGKERVEWVNE
Quantity
0.1 mL
Research Discipline
Neuroscience
Gene ID (Entrez)
8128
Target Species
Human
Isotype
IgG
Applications
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Formulation
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias
alpha-2,8-sialyltransferase 8B, alpha-2,8-sialyltransferase 8B 1, EC 2.4.99, EC 2.4.99.-, HsT19690, MGC116854, MGC116857, sialyltransferase 8 (alpha-2, 8-sialytransferase) B, Sialyltransferase 8B, Sialyltransferase X, Sialytransferase St8Sia II, SIAT8B, SIAT8-B, ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 2, ST8SIA-II, STXST8SiaII
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Related Products
Description
- ST8 alpha-2,8-Sialyltransferase 8B/ST8SIA2 Polyclonal specifically detects ST8 alpha-2,8-Sialyltransferase 8B/ST8SIA2 in Human samples
- It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: ST8 alpha-2,8-Sialyltransferase 8B/ST8SIA2
Classification: Polyclonal
Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200
Gene Accession No.: Q92186
Gene Symbols: ST8SIA2
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: SVIQRAFEDLVNATWREKLLQRLHSLNGSILWIPAFMARGGKERVEWVNE
Quantity: 0.1 mL
Research Discipline: Neuroscience
Gene ID (Entrez): 8128
Target Species: Human
Isotype: IgG
Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: alpha-2,8-sialyltransferase 8B, alpha-2,8-sialyltransferase 8B 1, EC 2.4.99, EC 2.4.99.-, HsT19690, MGC116854, MGC116857, sialyltransferase 8 (alpha-2, 8-sialytransferase) B, Sialyltransferase 8B, Sialyltransferase X, Sialytransferase St8Sia II, SIAT8B, SIAT8-B, ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 2, ST8SIA-II, STXST8SiaII
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: __
Classification: __
Dilution: __
Gene Accession No.: __
Gene Symbols: __
Immunogen: SVIQRAFEDLVNATWREKLLQRLHSLNGSILWIPAFMARGGKERVEWVNE
Quantity: 0.1mL
Research Discipline: __
Gene ID (Entrez): 8128
Target Species: __
Isotype: __
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: __
Host Species: __
Purification Method: Chromatography
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
Antigen: IST1
Classification: Polyclonal
Dilution: Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:20 - 1:50, Immunocytochemistry/Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:20 - 1:50
Gene Accession No.: P53990
Gene Symbols: IST1
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: LGSGFKAERLRVNLRLVINRLKLLEKKKTELAQKARKEIADYLAAGKDERARIRVEHIIREDYLVEAMEILELYCDLL
Quantity: 0.1 mL
Research Discipline: __
Gene ID (Entrez): 9798
Target Species: Human
Isotype: IgG
Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: IST1 homolog, increased sodium tolerance 1 homolog (yeast), OLC1
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
