MUDENG Antibody, Novus Biologicals™
Manufacturer: Novus Biologicals
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP233765-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP233765 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
MUDENG
Classification
Polyclonal
Dilution
Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50
Gene Accession No.
Q9H0R1
Gene Symbols
AP5M1
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: PLQDILVHPCVTSLDSAILTSSSIDAMDDSAFSGPYKFPFTPPLESFNLCFYTSQVPVPPILGFYQMKEEEVQLRITI
Quantity
0.1 mL
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Formulation
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias
Adapter-Related Protein Complex 5 Mu Subunit, Adaptor-Related Protein Complex 5, Mu 1 Subunit, AP-5 Complex Subunit Mu, AP-5 Complex Subunit Mu-1, C14orf108, Chromosome 14 Open Reading Frame 108, MHD Domain-Containing Death-Inducing Protein, Mu-2 Related Death-Inducing, Mu-2 Related Death-Inducing Gene, MU-2/AP1M2 Domain Containing, Death-Inducing, Mu-2-Related Death-Inducing Protein, Mu5, MuD, Putative HIV-1 Infection-Related Protein
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Gene ID (Entrez)
55745
Target Species
Human
Isotype
IgG
Related Products
Description
- MUDENG Polyclonal specifically detects MUDENG in Human samples
- It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: MUDENG
Classification: Polyclonal
Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50
Gene Accession No.: Q9H0R1
Gene Symbols: AP5M1
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: PLQDILVHPCVTSLDSAILTSSSIDAMDDSAFSGPYKFPFTPPLESFNLCFYTSQVPVPPILGFYQMKEEEVQLRITI
Quantity: 0.1 mL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: Adapter-Related Protein Complex 5 Mu Subunit, Adaptor-Related Protein Complex 5, Mu 1 Subunit, AP-5 Complex Subunit Mu, AP-5 Complex Subunit Mu-1, C14orf108, Chromosome 14 Open Reading Frame 108, MHD Domain-Containing Death-Inducing Protein, Mu-2 Related Death-Inducing, Mu-2 Related Death-Inducing Gene, MU-2/AP1M2 Domain Containing, Death-Inducing, Mu-2-Related Death-Inducing Protein, Mu5, MuD, Putative HIV-1 Infection-Related Protein
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 55745
Target Species: Human
Isotype: IgG
Antigen: __
Classification: __
Dilution: __
Gene Accession No.: __
Gene Symbols: __
Immunogen: SLVLIQEECVSEIADHSTEEPAEGGPDADGEEMTDGIEEDFDEDGGHELFLQIK
Quantity: 0.1mL
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: __
Host Species: __
Purification Method: Chromatography
Regulatory Status: RUO
Gene ID (Entrez): 138046
Target Species: __
Isotype: __
Antigen: MIA3
Classification: Polyclonal
Dilution: Western Blot 0.04 - 0.4 μg/mL, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500
Gene Accession No.: Q5JRA6
Gene Symbols: MIA3
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: DSKQGKPQSATDYSDPDNVDDGLFIVDIPKTNNDKEVNAEHHIKGKGRGVQESKRGLVQDETELEDENQEGMTVHSSVHSNNLNSMPA
Quantity: 0.1 mL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: ARNT, C219 Reactive Peptide, C219-Reactive Peptide, D320, KIAA0268, Melanoma Inhibitory Activity Family, Member 3, Melanoma Inhibitory Activity Protein 3, TANGO, TANGO1, Transport And Golgi Organization, Transport And Golgi Organization Protein 1, UNQ6077
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 375056
Target Species: Human
Isotype: IgG