SARS2 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP233807-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP233807 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
SARS2
Classification
Polyclonal
Dilution
Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500
Gene Accession No.
Q9NP81
Gene Symbols
SARS2
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: RSLEEEKAAVTEAVRALLANQDSGEVQQDPKYQGLRARGREIRKELVHLYPREAQLEEQFYLQALKLPNQTHPD
Quantity
0.1 mL
Research Discipline
Lipid and Metabolism
Gene ID (Entrez)
54938
Target Species
Human
Isotype
IgG
Applications
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Formulation
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias
EC 6.1.1.11, FLJ20450, mitochondrial seryl-tRNA synthetase, mtSerRS, SARS, serine tRNA ligase 2, mitochondrial, Serine--tRNA ligase, serine-tRNA ligase, mitochondrial, SerRS, SerRSmtSARSM, SERS, seryl-tRNA synthetase 2, seryl-tRNA synthetase 2, mitochondrial, seryl-tRNA synthetase, mitochondrial, Seryl-tRNA(Ser/Sec) synthetase, SYS
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Related Products
Description
- Description SARS2 Polyclonal specifically detects SARS2 in Human samples
- It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: SARS2
Classification: Polyclonal
Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500
Gene Accession No.: Q9NP81
Gene Symbols: SARS2
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: RSLEEEKAAVTEAVRALLANQDSGEVQQDPKYQGLRARGREIRKELVHLYPREAQLEEQFYLQALKLPNQTHPD
Quantity: 0.1 mL
Research Discipline: Lipid and Metabolism
Gene ID (Entrez): 54938
Target Species: Human
Isotype: IgG
Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: EC 6.1.1.11, FLJ20450, mitochondrial seryl-tRNA synthetase, mtSerRS, SARS, serine tRNA ligase 2, mitochondrial, Serine--tRNA ligase, serine-tRNA ligase, mitochondrial, SerRS, SerRSmtSARSM, SERS, seryl-tRNA synthetase 2, seryl-tRNA synthetase 2, mitochondrial, seryl-tRNA synthetase, mitochondrial, Seryl-tRNA(Ser/Sec) synthetase, SYS
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: EFHD1
Classification: Polyclonal
Dilution: Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500
Gene Accession No.: Q9BUP0
Gene Symbols: EFHD1
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: QALSSASKFEAELKAEQDERKREEE
Quantity: 0.1 mL
Research Discipline: __
Gene ID (Entrez): 80303
Target Species: Human
Isotype: IgG
Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: DKFZp781H0842, EF-hand domain family, member D1, EF-hand domain-containing protein 1, EF-hand domain-containing protein D1, member D1, MST133, MSTP133, Swiprosin-2
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: __
Classification: __
Dilution: __
Gene Accession No.: __
Gene Symbols: __
Immunogen: EDLNVGETQVNLEEGESGKIRRYKSNVMEKFFPIWDITTWPGNQRDFFYQGVHRHEEYLPCLLLPKRPQGRQPKTVA
Quantity: 0.1mL
Research Discipline: __
Gene ID (Entrez): 126205
Target Species: __
Isotype: __
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: __
Host Species: __
Purification Method: Chromatography
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.