TNFAIP8 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP233814-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP233814 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
TNFAIP8
Classification
Polyclonal
Dilution
Western Blot 0.4 ug/ml, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:500 - 1:1000
Gene Accession No.
O95379
Gene Symbols
TNFAIP8
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: AKSHGRVNNVFDHFSDCEFLAALYNPFGNFKPHLQKLCDGINKMLDEENI
Quantity
0.1 mL
Research Discipline
Apoptosis
Gene ID (Entrez)
25816
Target Species
Human
Isotype
IgG
Applications
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Formulation
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias
GG2-1, Head and neck tumor and metastasis-related protein, MDC-3.13TNF-induced protein GG2-1, NDED, NF-kappa-B-inducible DED-containing protein, SCC-S2SCCS2, TNF alpha-induced protein 8, tumor necrosis factor alpha-induced protein 8, tumor necrosis factor, alpha-induced protein 8
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Related Products
Description
- TNFAIP8 Polyclonal specifically detects TNFAIP8 in Human samples
- It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: TNFAIP8
Classification: Polyclonal
Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:500 - 1:1000
Gene Accession No.: O95379
Gene Symbols: TNFAIP8
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: AKSHGRVNNVFDHFSDCEFLAALYNPFGNFKPHLQKLCDGINKMLDEENI
Quantity: 0.1 mL
Research Discipline: Apoptosis
Gene ID (Entrez): 25816
Target Species: Human
Isotype: IgG
Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: GG2-1, Head and neck tumor and metastasis-related protein, MDC-3.13TNF-induced protein GG2-1, NDED, NF-kappa-B-inducible DED-containing protein, SCC-S2SCCS2, TNF alpha-induced protein 8, tumor necrosis factor alpha-induced protein 8, tumor necrosis factor, alpha-induced protein 8
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: __
Classification: __
Dilution: __
Gene Accession No.: __
Gene Symbols: __
Immunogen: AKSHGRVNNVFDHFSDCEFLAALYNPFGNFKPHLQKLCDGINKMLDEENI
Quantity: 0.1mL
Research Discipline: __
Gene ID (Entrez): 25816
Target Species: __
Isotype: __
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: __
Host Species: __
Purification Method: Chromatography
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
Antigen: MUDENG
Classification: Polyclonal
Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
Gene Accession No.: Q9H0R1
Gene Symbols: AP5M1
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: CPFGTLLDANLQNSLDNTNFASVTQPQKQPAWKTGTYKGKPQVSISITEKVKSMQYDKQGIADTWQVVGTVTCKCDLEGIMPNVTISLSLPT
Quantity: 0.1 mL
Research Discipline: __
Gene ID (Entrez): 55745
Target Species: Human
Isotype: IgG
Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: Adapter-Related Protein Complex 5 Mu Subunit, Adaptor-Related Protein Complex 5, Mu 1 Subunit, AP-5 Complex Subunit Mu, AP-5 Complex Subunit Mu-1, C14orf108, Chromosome 14 Open Reading Frame 108, MHD Domain-Containing Death-Inducing Protein, Mu-2 Related Death-Inducing, Mu-2 Related Death-Inducing Gene, MU-2/AP1M2 Domain Containing, Death-Inducing, Mu-2-Related Death-Inducing Protein, Mu5, MuD, Putative HIV-1 Infection-Related Protein
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.