PHLPP Antibody, Novus Biologicals™
Manufacturer: Novus Biologicals
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP233887-Each-of-1 | In Stock | ₹ 53,988.36 |
NBP233887 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,988.36
GST (18%): ₹ 9,717.905
Total Price: ₹ 63,706.265
Antigen
PHLPP
Classification
Polyclonal
Dilution
Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50
Gene Accession No.
O60346
Gene Symbols
PHLPP1
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: SLDRKTLLLKHRQTLQLQPSDRDWVRHQLQRGCVHVFDRHMASTYLRPVLCTLDTTAGEVAARLLQLGHKGGGVVKVLGQ
Quantity
0.1 mL
Research Discipline
Cancer, Protein Phosphatase, Tumor Suppressors
Gene ID (Entrez)
23239
Target Species
Human
Isotype
IgG
Applications
Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Formulation
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias
EC 3.1.3.16, hSCOP, KIAA0606, MGC161555, PH domain and leucine rich repeat protein phosphatase, PH domain and leucine rich repeat protein phosphatase 1, PH domain leucine-rich repeat-containing protein phosphatase 1, PHLPP, pleckstrin homology domain containing, family E (with leucine rich repeats)member 1, Pleckstrin homology domain-containing family E member 1, PLEKHE1, SCN circadian oscillatory protein, SCOPPH domain-containing family E member 1, Suprachiasmatic nucleus circadian oscillatory protein
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Related Products
Description
- PHLPP Polyclonal specifically detects PHLPP in Human samples
- It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: PHLPP
Classification: Polyclonal
Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50
Gene Accession No.: O60346
Gene Symbols: PHLPP1
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: SLDRKTLLLKHRQTLQLQPSDRDWVRHQLQRGCVHVFDRHMASTYLRPVLCTLDTTAGEVAARLLQLGHKGGGVVKVLGQ
Quantity: 0.1 mL
Research Discipline: Cancer, Protein Phosphatase, Tumor Suppressors
Gene ID (Entrez): 23239
Target Species: Human
Isotype: IgG
Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: EC 3.1.3.16, hSCOP, KIAA0606, MGC161555, PH domain and leucine rich repeat protein phosphatase, PH domain and leucine rich repeat protein phosphatase 1, PH domain leucine-rich repeat-containing protein phosphatase 1, PHLPP, pleckstrin homology domain containing, family E (with leucine rich repeats)member 1, Pleckstrin homology domain-containing family E member 1, PLEKHE1, SCN circadian oscillatory protein, SCOPPH domain-containing family E member 1, Suprachiasmatic nucleus circadian oscillatory protein
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: CIZ1
Classification: Polyclonal
Dilution: Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500
Gene Accession No.: Q9ULV3
Gene Symbols: CIZ1
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: EQTPVVVHVCGLEMPPDAVEAGGGMEKTLPEPVGTQVSMEEIQNESACGLDVGECENRAREMPGVWGAGGSLKVTIL
Quantity: 0.1 mL
Research Discipline: Cancer
Gene ID (Entrez): 25792
Target Species: Human, Mouse
Isotype: IgG
Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: CDKN1A interacting zinc finger protein 1, CDKN1A-interacting zinc finger protein 1, cip1-interacting zinc finger protein, LSFR1ZNF356Nuclear protein NP94, NP94, Zinc finger protein 356
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of human CIZ1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: __
Classification: __
Dilution: __
Gene Accession No.: __
Gene Symbols: __
Immunogen: EQTPVVVHVCGLEMPPDAVEAGGGMEKTLPEPVGTQVSMEEIQNESACGLDVGECENRAREMPGVWGAGGSLKVTIL
Quantity: 0.1mL
Research Discipline: __
Gene ID (Entrez): 25792
Target Species: __
Isotype: __
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: __
Host Species: __
Purification Method: Chromatography
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.