Thromboxane synthase Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP233948-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP233948 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
Thromboxane synthase
Classification
Polyclonal
Dilution
Western Blot 0.04-0.4 ug/ml, Simple Western reported by internal validation, Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000
Gene Accession No.
P24557
Gene Symbols
TBXAS1
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: RDFLQMVLDARHSASPMGVQDFDIVRDVFSSTGCKPNPSRQHQPSPMARPLTVDEI
Quantity
0.1 mL
Research Discipline
Lipid and Metabolism
Gene ID (Entrez)
6916
Target Species
Human
Isotype
IgG
Applications
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Formulation
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias
CYP5A1family 5, subfamily A, polypeptide 1, CYP5FLJ52771, EC 5.3.99.5, GHOSAL, platelet, cytochrome P450, subfamily V, thromboxane A synthase 1 (platelet), thromboxane A synthase 1 (platelet, cytochrome P450, family 5, subfamily A), thromboxane A synthase 1 (platelet, cytochrome P450, subfamily V), thromboxane-A synthase, TXA synthase
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Related Products
Description
- Thromboxane synthase Polyclonal specifically detects Thromboxane synthase in Human samples
- It is validated for Western Blot, Simple Western, Immunohistochemistry, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: Thromboxane synthase
Classification: Polyclonal
Dilution: Western Blot 0.04-0.4 ug/ml, Simple Western reported by internal validation, Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000
Gene Accession No.: P24557
Gene Symbols: TBXAS1
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: RDFLQMVLDARHSASPMGVQDFDIVRDVFSSTGCKPNPSRQHQPSPMARPLTVDEI
Quantity: 0.1 mL
Research Discipline: Lipid and Metabolism
Gene ID (Entrez): 6916
Target Species: Human
Isotype: IgG
Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: CYP5A1family 5, subfamily A, polypeptide 1, CYP5FLJ52771, EC 5.3.99.5, GHOSAL, platelet, cytochrome P450, subfamily V, thromboxane A synthase 1 (platelet), thromboxane A synthase 1 (platelet, cytochrome P450, family 5, subfamily A), thromboxane A synthase 1 (platelet, cytochrome P450, subfamily V), thromboxane-A synthase, TXA synthase
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: __
Classification: __
Dilution: __
Gene Accession No.: __
Gene Symbols: __
Immunogen: PSSNNSSEELSSALHLSKGMSIFLDILRRADKNDDGKLSFEEFKAYFADGVLSGEELHELFH
Quantity: 0.1mL
Research Discipline: __
Gene ID (Entrez): 64168
Target Species: __
Isotype: __
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: __
Host Species: __
Purification Method: Chromatography
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
Antigen: Prolyl Oligopeptidase/PREP
Classification: Polyclonal
Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:500 - 1:1000
Gene Accession No.: P48147
Gene Symbols: PREP
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: LSIREGCDPVNRLWYCDLQQESSGIAGILKWVKLIDNFEGEYDYVTNEGTVFTFKTNRQSPNYRVINIDFRDPEESKWKVLVPEHEKD
Quantity: 0.1 mL
Research Discipline: __
Gene ID (Entrez): 5550
Target Species: Human, Mouse
Isotype: IgG
Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: dJ355L5.1 (prolyl endopeptidase), EC 3.4.21.26, MGC16060, PE, PEP, Post-proline cleaving enzyme, prolyl endopeptidase, prolyl oligopeptidase
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.