CD40/TNFRSF5 Antibody, Novus Biologicals™
Manufacturer: Novus Biologicals
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP233957-Each-of-1 | In Stock | ₹ 55,271.76 |
NBP233957 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 55,271.76
GST (18%): ₹ 9,948.917
Total Price: ₹ 65,220.677
Antigen
CD40/TNFRSF5
Classification
Polyclonal
Dilution
Western Blot 1.0 μg/mL, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
Gene Accession No.
P25942
Gene Symbols
CD40
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: EGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQD
Quantity
0.1 mL
Research Discipline
Adaptive Immunity, Apoptosis, Asthma, Cancer, Hematopoietic Stem Cell Markers, Immunology, Signal Transduction, Stem Cell Markers
Gene ID (Entrez)
958
Target Species
Human
Isotype
IgG
Applications
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Formulation
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias
B cell surface antigen CD40, B-cell surface antigen CD40, Bp50B cell-associated molecule, CD40 antigen, CD40 molecule, TNF receptor superfamily member 5, CD40 type II isoform, CD40L receptor, CDw40, MGC9013, nerve growth factor receptor-related B-lymphocyte activation molecule, p50, TNFRSF5CD40 antigen (TNF receptor superfamily member 5), tumor necrosis factor receptor superfamily member 5, tumor necrosis factor receptor superfamily, member 5
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Related Products
Description
- CD40/TNFRSF5 Polyclonal specifically detects CD40/TNFRSF5 in Human samples
- It is validated for Western Blot.
Compare Similar Items
Show Difference
Antigen: CD40/TNFRSF5
Classification: Polyclonal
Dilution: Western Blot 1.0 μg/mL, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
Gene Accession No.: P25942
Gene Symbols: CD40
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: EGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQD
Quantity: 0.1 mL
Research Discipline: Adaptive Immunity, Apoptosis, Asthma, Cancer, Hematopoietic Stem Cell Markers, Immunology, Signal Transduction, Stem Cell Markers
Gene ID (Entrez): 958
Target Species: Human
Isotype: IgG
Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: B cell surface antigen CD40, B-cell surface antigen CD40, Bp50B cell-associated molecule, CD40 antigen, CD40 molecule, TNF receptor superfamily member 5, CD40 type II isoform, CD40L receptor, CDw40, MGC9013, nerve growth factor receptor-related B-lymphocyte activation molecule, p50, TNFRSF5CD40 antigen (TNF receptor superfamily member 5), tumor necrosis factor receptor superfamily member 5, tumor necrosis factor receptor superfamily, member 5
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: CLNS1A
Classification: Polyclonal
Dilution: Western Blot, Immunohistochemistry 1:20 - 1:50, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:20 - 1:50
Gene Accession No.: P54105
Gene Symbols: CLNS1A
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: YTYEEGLSHLTAEGQATLERLEGMLSQSVSSQYNMAGVRTEDSIRDYEDGMEVDTTPTVAGQFEDADVDH
Quantity: 0.1 mL
Research Discipline: DNA replication Transcription Translation and Splicing
Gene ID (Entrez): 1207
Target Species: Human
Isotype: IgG
Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: chloride channel regulatory protein, Chloride channel, nucleotide sensitive 1A, chloride channel, nucleotide-sensitive, 1A, Chloride conductance regulatory protein ICln, Chloride ion current inducer protein, ClCI, CLNS1B, I(Cln), ICln, methylosome subunit pICln, Reticulocyte pICln, reticulocyte protein ICln
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: CLNS1A
Classification: Polyclonal
Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
Gene Accession No.: P54105
Gene Symbols: CLNS1A
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: EDSDDDVEPITEFRFVPSDKSALEAMFTAMCECQALHPDPEDEDSDDYDGEEYDVEAHEQGQ
Quantity: 0.1 mL
Research Discipline: DNA replication Transcription Translation and Splicing
Gene ID (Entrez): 1207
Target Species: Human
Isotype: IgG
Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: chloride channel regulatory protein, Chloride channel, nucleotide sensitive 1A, chloride channel, nucleotide-sensitive, 1A, Chloride conductance regulatory protein ICln, Chloride ion current inducer protein, ClCI, CLNS1B, I(Cln), ICln, methylosome subunit pICln, Reticulocyte pICln, reticulocyte protein ICln
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
