GluR1 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP233996-Each-of-1 | In Stock | ₹ 55,271.76 |
NBP233996 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 55,271.76
GST (18%): ₹ 9,948.917
Total Price: ₹ 65,220.677
Antigen
GluR1
Classification
Polyclonal
Dilution
Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500
Gene Accession No.
P42261
Gene Symbols
GRIA1
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: VRFEGLTGNVQFNEKGRRTNYTLHVIEMKHDGIRKIGYWNEDDKFVPAATDAQAGGDNSSVQN
Quantity
0.1 mL
Research Discipline
GPCR, Metabotropic Glutamate Receptors, Neuronal Cell Markers, Neuroscience, Neurotransmission, Vision
Gene ID (Entrez)
2890
Target Species
Human
Isotype
IgG
Applications
Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Formulation
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias
AMPA 1, AMPA-selective glutamate receptor 1, GluA1, GLUH1, GluR-1, GLUR1gluR-A, GluR-A, GLURA, GluR-K1, glutamate receptor 1, Glutamate receptor ionotropic, AMPA 1, glutamate receptor, ionotropic, AMPA 1, HBGR1, MGC133252
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Related Products
Description
- Description GluR1 Polyclonal specifically detects GluR1 in Human samples
- It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: GluR1
Classification: Polyclonal
Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500
Gene Accession No.: P42261
Gene Symbols: GRIA1
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: VRFEGLTGNVQFNEKGRRTNYTLHVIEMKHDGIRKIGYWNEDDKFVPAATDAQAGGDNSSVQN
Quantity: 0.1 mL
Research Discipline: GPCR, Metabotropic Glutamate Receptors, Neuronal Cell Markers, Neuroscience, Neurotransmission, Vision
Gene ID (Entrez): 2890
Target Species: Human
Isotype: IgG
Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: AMPA 1, AMPA-selective glutamate receptor 1, GluA1, GLUH1, GluR-1, GLUR1gluR-A, GluR-A, GLURA, GluR-K1, glutamate receptor 1, Glutamate receptor ionotropic, AMPA 1, glutamate receptor, ionotropic, AMPA 1, HBGR1, MGC133252
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: __
Classification: __
Dilution: __
Gene Accession No.: __
Gene Symbols: __
Immunogen: EPRIRNIIQQAIDAGEVPSYNAFVKESKQKMNARKRRAQEEAKEAEMSRKELGLDEGVDSLKAAIQSRQKDRQKEMDNFLAQMEAKYCKS
Quantity: 0.1mL
Research Discipline: __
Gene ID (Entrez): 23234
Target Species: __
Isotype: __
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: __
Host Species: __
Purification Method: Chromatography
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
Antigen: CCDC14
Classification: Polyclonal
Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:20 - 1:50
Gene Accession No.: Q49A88
Gene Symbols: CCDC14
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: TCTDVLRNSFNTSPGVPCSLPKTDISAIPTLQQLGLVNGILPQQGIHKETDLLKCIQTYLSLFRSHGKETHLDSQTHRSPTQSQPAFLA
Quantity: 0.1 mL
Research Discipline: __
Gene ID (Entrez): 64770
Target Species: Human
Isotype: IgG
Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: coiled-coil domain containing 14, DKFZp434L1050, FLJ12892
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.