Alkaline Phosphatase/ALPP Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP234056-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP234056 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
Alkaline Phosphatase/ALPP
Classification
Polyclonal
Dilution
Western Blot 0.4 ug/ml, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin 1:50 - 1:200
Gene Accession No.
P05187
Gene Symbols
ALPP
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: NWYSDADVPASARQEGCQDIATQLISNMDI
Quantity
0.1 mL
Research Discipline
Cancer, Embryonic Stem Cell Markers, Ovarian Carcinoma Cell Markers, Stem Cell Markers
Gene ID (Entrez)
250
Target Species
Human
Isotype
IgG
Applications
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Formulation
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias
Alkaline phosphatase Regan isozyme, alkaline phosphatase, placental, alkaline phosphatase, placental (Regan isozyme), alkaline phosphatase, placental type, alkaline phosphomonoesterase, ALP, EC 3.1.3.1, FLJ61142, glycerophosphatase, PALP, Placental alkaline phosphatase 1, PLAP, PLAP-1, Regan isozyme
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Related Products
Description
- Alkaline Phosphatase/ALPP Polyclonal specifically detects Alkaline Phosphatase/ALPP in Human samples
- It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: Alkaline Phosphatase/ALPP
Classification: Polyclonal
Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin 1:50 - 1:200
Gene Accession No.: P05187
Gene Symbols: ALPP
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: NWYSDADVPASARQEGCQDIATQLISNMDI
Quantity: 0.1 mL
Research Discipline: Cancer, Embryonic Stem Cell Markers, Ovarian Carcinoma Cell Markers, Stem Cell Markers
Gene ID (Entrez): 250
Target Species: Human
Isotype: IgG
Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: Alkaline phosphatase Regan isozyme, alkaline phosphatase, placental, alkaline phosphatase, placental (Regan isozyme), alkaline phosphatase, placental type, alkaline phosphomonoesterase, ALP, EC 3.1.3.1, FLJ61142, glycerophosphatase, PALP, Placental alkaline phosphatase 1, PLAP, PLAP-1, Regan isozyme
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: __
Classification: __
Dilution: __
Gene Accession No.: __
Gene Symbols: __
Immunogen: NWYSDADVPASARQEGCQDIATQLISNMDI
Quantity: 0.1mL
Research Discipline: __
Gene ID (Entrez): 250
Target Species: __
Isotype: __
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: __
Host Species: __
Purification Method: Chromatography
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
Antigen: SLC39A8/ZIP8
Classification: Polyclonal
Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50
Gene Accession No.: Q9C0K1
Gene Symbols: SLC39A8
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: LKTYGQNGHTHFGNDNFGPQEKTHQPKALPAINGVTCYANPAVTEANGHIHFDNVSVVSLQDGKKEPSSCTCL
Quantity: 0.1 mL
Research Discipline: __
Gene ID (Entrez): 64116
Target Species: Human
Isotype: IgG
Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: BCG induced integral membrane protein BIGM103, BIGM103BCG-induced integral membrane protein in monocyte clone 103 protein, LIV-1 subfamily of ZIP zinc transporter 6, LZT-Hs6, solute carrier family 39 (metal ion transporter), member 8, solute carrier family 39 (zinc transporter), member 8, Solute carrier family 39 member 8, zinc transporter ZIP8, ZIP8, ZIP-8, Zrt- and Irt-like protein 8
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.