Ferritin Light Chain Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP234072-Each-of-1 | In Stock | ₹ 55,271.76 |
NBP234072 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 55,271.76
GST (18%): ₹ 9,948.917
Total Price: ₹ 65,220.677
Antigen
Ferritin Light Chain
Classification
Polyclonal
Dilution
Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:1000 - 1:2500
Gene Accession No.
P02792
Gene Symbols
FTL
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: LFQDIKKPAEDEWGKTPDAMKAAMALEKKLNQALLDLHALGSARTD
Quantity
0.1 mL
Research Discipline
Cancer
Gene ID (Entrez)
2512
Target Species
Human
Isotype
IgG
Applications
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Formulation
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias
Ferritin L subunit, ferritin L-chain, ferritin light chain, ferritin light polypeptide-like 3, ferritin, light polypeptide, MGC71996, NBIA3
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Related Products
Description
- Ferritin Light Chain Polyclonal specifically detects Ferritin Light Chain in Human samples
- It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: Ferritin Light Chain
Classification: Polyclonal
Dilution: Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:1000 - 1:2500
Gene Accession No.: P02792
Gene Symbols: FTL
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: LFQDIKKPAEDEWGKTPDAMKAAMALEKKLNQALLDLHALGSARTD
Quantity: 0.1 mL
Research Discipline: Cancer
Gene ID (Entrez): 2512
Target Species: Human
Isotype: IgG
Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: Ferritin L subunit, ferritin L-chain, ferritin light chain, ferritin light polypeptide-like 3, ferritin, light polypeptide, MGC71996, NBIA3
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: __
Classification: __
Dilution: __
Gene Accession No.: __
Gene Symbols: __
Immunogen: LFQDIKKPAEDEWGKTPDAMKAAMALEKKLNQALLDLHALGSARTD
Quantity: 0.1mL
Research Discipline: __
Gene ID (Entrez): 2512
Target Species: __
Isotype: __
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: __
Host Species: __
Purification Method: Chromatography
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
Antigen: SUMO4
Classification: Polyclonal
Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:500 - 1:1000
Gene Accession No.: Q6EEV6
Gene Symbols: SUMO4
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: TDKPAQLEMEDEDTIDVFQQPTGGV
Quantity: 0.1 mL
Research Discipline: Protein Phosphatase
Gene ID (Entrez): 387082
Target Species: Human
Isotype: IgG
Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: dJ281H8.4, IDDM5, small ubiquitin-like modifier 4 protein, Small ubiquitin-like protein 4, small ubiquitin-related modifier 4, SMT3 suppressor of mif two 3 homolog 2, SMT3 suppressor of mif two 3 homolog 4 (S. cerevisiae), SMT3 suppressor of mif two 3 homolog 4 (yeast), SMT3H4, SUMO-4
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.