SERCA2 ATPase Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP234147-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP234147 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
SERCA2 ATPase
Classification
Polyclonal
Dilution
Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:500 - 1:1000
Gene Accession No.
P16615
Gene Symbols
ATP2A2
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: TVEEVLGHFGVNESTGLSLEQVKKLKERWGSNELPA
Quantity
0.1 mL
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Formulation
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias
ATP2BFLJ20293, ATPase, Ca++ dependent, slow-twitch, cardiac muscle-2, ATPase, Ca++ transporting, cardiac muscle, slow twitch 2, Calcium pump 2, Calcium-transporting ATPase sarcoplasmic reticulum type, slow twitch skeletalmuscle isoform, cardiac Ca2+ ATPase, DAR, DD, EC 3.6.3, EC 3.6.3.8, Endoplasmic reticulum class 1/2 Ca(2+) ATPase, FLJ38063, MGC45367, sarcoplasmic/endoplasmic reticulum calcium ATPase 2, SERCA2DKFZp686P0211, SR Ca(2+)-ATPase 2
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Gene ID (Entrez)
488
Target Species
Human
Isotype
IgG
Related Products
Description
- Description SERCA2 ATPase Polyclonal specifically detects SERCA2 ATPase in Human samples
- It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: SERCA2 ATPase
Classification: Polyclonal
Dilution: Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:500 - 1:1000
Gene Accession No.: P16615
Gene Symbols: ATP2A2
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: TVEEVLGHFGVNESTGLSLEQVKKLKERWGSNELPA
Quantity: 0.1 mL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: ATP2BFLJ20293, ATPase, Ca++ dependent, slow-twitch, cardiac muscle-2, ATPase, Ca++ transporting, cardiac muscle, slow twitch 2, Calcium pump 2, Calcium-transporting ATPase sarcoplasmic reticulum type, slow twitch skeletalmuscle isoform, cardiac Ca2+ ATPase, DAR, DD, EC 3.6.3, EC 3.6.3.8, Endoplasmic reticulum class 1/2 Ca(2+) ATPase, FLJ38063, MGC45367, sarcoplasmic/endoplasmic reticulum calcium ATPase 2, SERCA2DKFZp686P0211, SR Ca(2+)-ATPase 2
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 488
Target Species: Human
Isotype: IgG
Antigen: __
Classification: __
Dilution: __
Gene Accession No.: __
Gene Symbols: __
Immunogen: TVEEVLGHFGVNESTGLSLEQVKKLKERWGSNELPA
Quantity: 0.1mL
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: __
Host Species: __
Purification Method: Chromatography
Regulatory Status: RUO
Gene ID (Entrez): 488
Target Species: __
Isotype: __
Antigen: VIPR2/VPAC2
Classification: Polyclonal
Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000
Gene Accession No.: P41587
Gene Symbols: VIPR2
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: NSIHPECRFHLEIQEEETKCAELLRSQTEKHKACSGVWDNITCWR
Quantity: 0.1 mL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: FLJ16511, Helodermin-preferring VIP receptor, PACAP type III receptor, PACAP-R3, PACAP-R-3, Pituitary adenylate cyclase-activating polypeptide type III receptor, vasoactive intestinal peptide receptor 2, vasoactive intestinal polypeptide receptor 2, VIP2R, VIP-R-2, VPAC2, VPCAP2R
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 7434
Target Species: Human
Isotype: IgG