ACTH Mouse, Clone: AH26 + 57, Novus Biologicals™
Manufacturer: Fischer Scientific
The price for this product is unavailable. Please request a quote
Antigen
ACTH
Classification
Monoclonal
Conjugate
Unconjugated
Formulation
PBS with 0.05% BSA. with 0.05% Sodium Azide
Gene Alias
ACTH, adrenocorticotropic hormone, adrenocorticotropin, alpha-melanocyte-stimulating hormone, alpha-MSH, beta-endorphin, beta-LPH, beta-melanocyte-stimulating hormone, beta-MSH, CLIP, corticotropin-like intermediary peptide, corticotropin-lipotropin, gamma-LPH, gamma-MSH, lipotropin beta, lipotropin gamma, LPH, melanotropin alpha, melanotropin beta, melanotropin gamma, met-enkephalin, MSH, NPP, POC, pro-ACTH-endorphin, proopiomelanocortin, pro-opiomelanocortin, proopiomelanocortin preproprotein
Host Species
Mouse
Purification Method
Protein A purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
ACTH (same as Corticotropin) is a 39 amino acid active peptide produced by the anterior pituitary. This MAb is specific to Synacthen (aa1-24 of ACTH); does not react with CLIP (aa17-39 of ACTH). POMC (pro-opiomelanocortin or corticotropin-lipotropin) is a 267 amino acid polypeptide hormone precursor that goes through extensive, tissue-specific posttranslational processing by convertases. POMC is cleaved into ten hormone chains named NPP, ACTH, alpha-MSH (Melanocyte Stimulating Hormone), beta-MSH, gamma-MSH, CLIP (corticotropin-like intermediary peptide), Lipotropin-beta, Lipotropin-gamma, beta-endorphin and Met-enkephalin. ACTH is also produced by cells of immune system (T-cells, B-cells, and macrophages) in response to stimuli associated with stress. Anti-ACTH is a useful marker in classification of pituitary tumors and the study of pituitary disease. It reacts with ACTH-producing cells (corticotrophs). It also may react with other tumors (e.g. some small cell carcinomas of the lung) causing paraneoplastic syndromes by secreting ACTH.
Content And Storage
Store at 4C.
Isotype
IgG
Applications
Western Blot, Flow Cytometry, Immunocytochemistry, Immunofluorescence, Immunoprecipitation, Immunohistochemistry (Paraffin)
Clone
AH26 + 57
Dilution
Western Blot 0.5-1.0ug/ml, Flow Cytometry 0.5-1ug/million cells, Immunocytochemistry/Immunofluorescence 0.5-1ug/ml, Immunoprecipitation 0.5-1ug/500ug protein lysate, Immunohistochemistry-Paraffin 0.5-1ug/ml, Immunohistochemistry-Frozen 0.5-1ug/ml
Gene Accession No.
P01189
Gene Symbols
POMC
Immunogen
Synthetic peptide corresponding to aa1-24 of human ACTH (AH26); N-terminal fragment of human ACTH conjugated to KLH (57)
Quantity
0.2 mg
Research Discipline
Neuroscience, Nutrient Sensing in the Brain
Gene ID (Entrez)
5443
Target Species
Human, Mouse, Rat
Form
Purified
Related Products
Description
- ACTH Monoclonal specifically detects ACTH in Human, Mouse, Rat samples
- It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: ACTH
Classification: Monoclonal
Conjugate: Unconjugated
Formulation: PBS with 0.05% BSA. with 0.05% Sodium Azide
Gene Alias: ACTH, adrenocorticotropic hormone, adrenocorticotropin, alpha-melanocyte-stimulating hormone, alpha-MSH, beta-endorphin, beta-LPH, beta-melanocyte-stimulating hormone, beta-MSH, CLIP, corticotropin-like intermediary peptide, corticotropin-lipotropin, gamma-LPH, gamma-MSH, lipotropin beta, lipotropin gamma, LPH, melanotropin alpha, melanotropin beta, melanotropin gamma, met-enkephalin, MSH, NPP, POC, pro-ACTH-endorphin, proopiomelanocortin, pro-opiomelanocortin, proopiomelanocortin preproprotein
Host Species: Mouse
Purification Method: Protein A purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: ACTH (same as Corticotropin) is a 39 amino acid active peptide produced by the anterior pituitary. This MAb is specific to Synacthen (aa1-24 of ACTH); does not react with CLIP (aa17-39 of ACTH). POMC (pro-opiomelanocortin or corticotropin-lipotropin) is a 267 amino acid polypeptide hormone precursor that goes through extensive, tissue-specific posttranslational processing by convertases. POMC is cleaved into ten hormone chains named NPP, ACTH, alpha-MSH (Melanocyte Stimulating Hormone), beta-MSH, gamma-MSH, CLIP (corticotropin-like intermediary peptide), Lipotropin-beta, Lipotropin-gamma, beta-endorphin and Met-enkephalin. ACTH is also produced by cells of immune system (T-cells, B-cells, and macrophages) in response to stimuli associated with stress. Anti-ACTH is a useful marker in classification of pituitary tumors and the study of pituitary disease. It reacts with ACTH-producing cells (corticotrophs). It also may react with other tumors (e.g. some small cell carcinomas of the lung) causing paraneoplastic syndromes by secreting ACTH.
Content And Storage: Store at 4C.
Isotype: IgG
Applications: Western Blot, Flow Cytometry, Immunocytochemistry, Immunofluorescence, Immunoprecipitation, Immunohistochemistry (Paraffin)
Clone: AH26 + 57
Dilution: Western Blot 0.5-1.0ug/ml, Flow Cytometry 0.5-1ug/million cells, Immunocytochemistry/Immunofluorescence 0.5-1ug/ml, Immunoprecipitation 0.5-1ug/500ug protein lysate, Immunohistochemistry-Paraffin 0.5-1ug/ml, Immunohistochemistry-Frozen 0.5-1ug/ml
Gene Accession No.: P01189
Gene Symbols: POMC
Immunogen: Synthetic peptide corresponding to aa1-24 of human ACTH (AH26); N-terminal fragment of human ACTH conjugated to KLH (57)
Quantity: 0.2 mg
Research Discipline: Neuroscience, Nutrient Sensing in the Brain
Gene ID (Entrez): 5443
Target Species: Human, Mouse, Rat
Form: Purified
Antigen: ACTH
Classification: Monoclonal
Conjugate: Unconjugated
Formulation: PBS with 0.05% BSA. with 0.05% Sodium Azide
Gene Alias: ACTH, adrenocorticotropic hormone, adrenocorticotropin, alpha-melanocyte-stimulating hormone, alpha-MSH, beta-endorphin, beta-LPH, beta-melanocyte-stimulating hormone, beta-MSH, CLIP, corticotropin-like intermediary peptide, corticotropin-lipotropin, gamma-LPH, gamma-MSH, lipotropin beta, lipotropin gamma, LPH, melanotropin alpha, melanotropin beta, melanotropin gamma, met-enkephalin, MSH, NPP, POC, pro-ACTH-endorphin, proopiomelanocortin, pro-opiomelanocortin, proopiomelanocortin preproprotein
Host Species: Mouse
Purification Method: Protein A purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: ACTH (same as Corticotropin) is a 39 amino acid active peptide produced by the anterior pituitary. This MAb is specific to Synacthen (aa1-24 of ACTH); does not react with CLIP (aa17-39 of ACTH). POMC (pro-opiomelanocortin or corticotropin-lipotropin) is a 267 amino acid polypeptide hormone precursor that goes through extensive, tissue-specific posttranslational processing by convertases. POMC is cleaved into ten hormone chains named NPP, ACTH, alpha-MSH (Melanocyte Stimulating Hormone), beta-MSH, gamma-MSH, CLIP (corticotropin-like intermediary peptide), Lipotropin-beta, Lipotropin-gamma, beta-endorphin and Met-enkephalin. ACTH is also produced by cells of immune system (T-cells, B-cells, and macrophages) in response to stimuli associated with stress. Anti-ACTH is a useful marker in classification of pituitary tumors and the study of pituitary disease. It reacts with ACTH-producing cells (corticotrophs). It also may react with other tumors (e.g. some small cell carcinomas of the lung) causing paraneoplastic syndromes by secreting ACTH.
Content And Storage: Store at 4C.
Isotype: IgG
Applications: Western Blot, Flow Cytometry, Immunocytochemistry, Immunofluorescence, Immunoprecipitation, Immunohistochemistry (Paraffin)
Clone: AH26 + 57
Dilution: Western Blot 0.5-1.0ug/ml, Flow Cytometry 0.5-1ug/million cells, Immunocytochemistry/Immunofluorescence 0.5-1ug/ml, Immunoprecipitation 0.5-1ug/500ug protein lysate, Immunohistochemistry-Paraffin 0.5-1ug/ml, Immunohistochemistry-Frozen 0.5-1ug/ml
Gene Accession No.: P01189
Gene Symbols: POMC
Immunogen: Synthetic peptide corresponding to aa1-24 of human ACTH (AH26); N-terminal fragment of human ACTH conjugated to KLH (57)
Quantity: 0.02 mg
Research Discipline: Neuroscience, Nutrient Sensing in the Brain
Gene ID (Entrez): 5443
Target Species: Human, Mouse, Rat
Form: Purified
Antigen: DOG1/TMEM16A
Classification: Monoclonal
Conjugate: Unconjugated
Formulation: PBS with 0.05% BSA. with 0.05% Sodium Azide
Gene Alias: ANO1, anoctamin 1, DOG1, ORAOV2, TAOS2, TMEM16A
Host Species: Mouse
Purification Method: Protein A purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Expression of DOG-1 protein is elevated in the gastrointestinal stromal tumors (GISTs), c-kit signaling-driven mesenchymal tumors of the GI tract. DOG-1 is rarely expressed in other soft tissue tumors, which, due to appearance, may be difficult to diagnose. Immunoreactivity for DOG-1 has been reported in 97.8 percent of scorable GISTs, including all c-kit negative GISTs. Overexpression of DOG-1 has been suggested to aid in the identification of GISTs, including Platelet-Derived Growth Factor Receptor Alpha mutants that fail to express c-kit antigen. The overall sensitivity of DOG1 and c-kit in GISTs is nearly identical: 94.4% vs. 94.7%.
Content And Storage: Store at 4C.
Isotype: IgG
Applications: Western Blot, Flow Cytometry, Immunocytochemistry, Immunofluorescence, Immunoprecipitation, Immunohistochemistry (Paraffin)
Clone: DG1/447 + DOG-1.1
Dilution: Western Blot 0.5-1.0ug/ml, Flow Cytometry 0.5-1ug/million cells, Immunocytochemistry/Immunofluorescence 0.5-1ug/ml, Immunoprecipitation 0.5-1ug/500ug protein lysate, Immunohistochemistry-Paraffin 0.5-1ug/ml, Immunohistochemistry-Frozen 0.5-1ug/ml
Gene Accession No.: Q5XXA6
Gene Symbols: ANO1
Immunogen: Recombinant human DOG-1 protein (DG1/447); A synthetic peptide from human DOG-1 protein (MSDFVDWVIPDIPKDISQQIHK-EKVLMVELFMREEQDKQQLLETCMEKER QKDEPPCNHHNTKACPDSLGSPAPSHAYHGGVL), conjugated to a carrier protein (DOG-1.1)
Quantity: 0.1 mg
Research Discipline: __
Gene ID (Entrez): 55107
Target Species: Human
Form: Purified