p53 Antibody (SPM589), Alexa Fluor™ 700, Novus Biologicals™
Manufacturer: Novus Biologicals
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP234817Z-Each-of-1 | In Stock | ₹ 56,298.48 |
NBP234817Z - Each of 1
In Stock
Quantity
1
Base Price: ₹ 56,298.48
GST (18%): ₹ 10,133.726
Total Price: ₹ 66,432.206
Antigen
p53
Classification
Monoclonal
Conjugate
Alexa Fluor 700
Gene Alias
Antigen NY-CO-13, FLJ92943, LFS1TRP53, p53, p53 tumor suppressor, P53cellular tumor antigen p53, Phosphoprotein p53, transformation-related protein 53, tumor protein p53, Tumor suppressor p53
Host Species
Mouse
Molecular Weight of Antigen
53 kDa
Quantity
0.1 mL
Research Discipline
Apoptosis, Cancer, Cell Cycle and Replication, Cellular Markers, Checkpoint signaling, Core ESC Like Genes, DNA Double Strand Break Repair, DNA Repair, HIF Target Genes, Hypoxia, Neuroscience, Neurotransmission, p53 Pathway, Stem Cell Markers, Transcription Factors and Regulators, Tumor Suppressors
Gene ID (Entrez)
7157
Target Species
Human, Mouse (Negative), Rat (Negative)
Form
Purified
Applications
Western Blot, Flow Cytometry, ELISA, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin), Immunohistochemistry (Frozen)
Clone
SPM589
Dilution
Western Blot, Flow Cytometry, ELISA 1-5 μg/mL for coating, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen
Gene Symbols
TP53
Immunogen
Recombinant human wild-type p53 protein (Uniprot: P04637)
Purification Method
Protein A or G purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Recognizes a 53kDa protein, which is identified as p53 suppressor gene product. It reacts with the mutant as well as the wild form of p53 under denaturing and non-denaturing conditions. Its epitope maps within the N-terminus (aa 20-25) of p53 oncoprotein. p53 is a tumor suppressor gene expressed in a wide variety of tissue types and is involved in regulating cell growth, replication, and apoptosis. It binds to MDM2, SV40 T antigen and human papilloma virus E6 protein. Positive nuclear staining with p53 antibody has been reported to be a negative prognostic factor in breast carcinoma, lung carcinoma, colorectal, and urothelial carcinoma. Anti-p53 positivity has also been used to differentiate uterine serous carcinoma from endometrioid carcinoma as well as to detect intratubular germ cell neoplasia. Mutations involving p53 are found in a wide variety of malignant tumors, including breast, ovarian, bladder, colon, lung, and melanoma.
Content And Storage
Store at 4C in the dark.
Isotype
IgG2a κ
Related Products
Description
- Description p53 Monoclonal specifically detects p53 in Human, Mouse (Negative), Rat (Negative) samples
- It is validated for Western Blot, Flow Cytometry, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: p53
Classification: Monoclonal
Conjugate: Alexa Fluor 700
Gene Alias: Antigen NY-CO-13, FLJ92943, LFS1TRP53, p53, p53 tumor suppressor, P53cellular tumor antigen p53, Phosphoprotein p53, transformation-related protein 53, tumor protein p53, Tumor suppressor p53
Host Species: Mouse
Molecular Weight of Antigen: 53 kDa
Quantity: 0.1 mL
Research Discipline: Apoptosis, Cancer, Cell Cycle and Replication, Cellular Markers, Checkpoint signaling, Core ESC Like Genes, DNA Double Strand Break Repair, DNA Repair, HIF Target Genes, Hypoxia, Neuroscience, Neurotransmission, p53 Pathway, Stem Cell Markers, Transcription Factors and Regulators, Tumor Suppressors
Gene ID (Entrez): 7157
Target Species: Human, Mouse (Negative), Rat (Negative)
Form: Purified
Applications: Western Blot, Flow Cytometry, ELISA, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin), Immunohistochemistry (Frozen)
Clone: SPM589
Dilution: Western Blot, Flow Cytometry, ELISA 1-5 μg/mL for coating, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen
Gene Symbols: TP53
Immunogen: Recombinant human wild-type p53 protein (Uniprot: P04637)
Purification Method: Protein A or G purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Recognizes a 53kDa protein, which is identified as p53 suppressor gene product. It reacts with the mutant as well as the wild form of p53 under denaturing and non-denaturing conditions. Its epitope maps within the N-terminus (aa 20-25) of p53 oncoprotein. p53 is a tumor suppressor gene expressed in a wide variety of tissue types and is involved in regulating cell growth, replication, and apoptosis. It binds to MDM2, SV40 T antigen and human papilloma virus E6 protein. Positive nuclear staining with p53 antibody has been reported to be a negative prognostic factor in breast carcinoma, lung carcinoma, colorectal, and urothelial carcinoma. Anti-p53 positivity has also been used to differentiate uterine serous carcinoma from endometrioid carcinoma as well as to detect intratubular germ cell neoplasia. Mutations involving p53 are found in a wide variety of malignant tumors, including breast, ovarian, bladder, colon, lung, and melanoma.
Content And Storage: Store at 4C in the dark.
Isotype: IgG2a κ
Antigen: Collagen VI alpha 3
Classification: Polyclonal
Conjugate: Unconjugated
Gene Alias: Collagen Alpha-3(VI) Chain, Collagen VI, Alpha-3 Polypeptide, collagen, type VI, alpha 3
Host Species: Rabbit
Molecular Weight of Antigen: __
Quantity: 0.1 mL
Research Discipline: __
Gene ID (Entrez): 1293
Target Species: Human
Form: __
Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Clone: __
Dilution: Western Blot 0.04-0.4 μg/mL, Simple Western 1:25, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
Gene Symbols: COL6A3
Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:PRDLKIVVLMLTGEVPEQQLEEAQRVILQAKCKGYFFVVLGIGRKVNIKEVYTFASEPNDVFFKLVDKSTELNEEPLMRFGRLLPSFVSSENAFYLSPDIRKQCDWFQGDQPTKNLVKFGHKQVNVPNNVTSSPTSNPVTTTKPVT
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype: IgG
Antigen: __
Classification: __
Conjugate: __
Gene Alias: Collagen Alpha-3(VI) Chain, Collagen VI, Alpha-3 Polypeptide, collagen, type VI, alpha 3
Host Species: __
Molecular Weight of Antigen: __
Quantity: __
Research Discipline: __
Gene ID (Entrez): 1293
Target Species: __
Form: __
Applications: __
Clone: __
Dilution: __
Gene Symbols: __
Immunogen: __
Purification Method: __
Regulatory Status: __
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
Isotype: __
