ELAVL2 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP238012-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP238012 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
ELAVL2
Classification
Polyclonal
Dilution
Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:500 - 1:1000
Gene Alias
ELAV (embryonic lethal, abnormal vision, Drosophila)-like 2 (Hu antigen B), ELAV-like neuronal protein 1, ELAV-like protein 2, HELN1, HEL-N1, Hu-antigen B, HuB, HUBELAV (embryonic lethal, abnormal vision, Drosophila)-like 2, Nervous system-specific RNA-binding protein Hel-N1
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Formulation
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols
ELAVL2
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: MAVRLCDVASLLRSGSWAAEPWTGQVIAAMETQLSNGPTCNNTANGPTTINNNCSSPVDSGNTEDSKTNL
Quantity
0.1 mL
Research Discipline
Neuroscience, Vision
Gene ID (Entrez)
1993
Target Species
Human
Isotype
IgG
Related Products
Description
- ELAVL2 Polyclonal specifically detects ELAVL2 in Human samples
- It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: ELAVL2
Classification: Polyclonal
Dilution: Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:500 - 1:1000
Gene Alias: ELAV (embryonic lethal, abnormal vision, Drosophila)-like 2 (Hu antigen B), ELAV-like neuronal protein 1, ELAV-like protein 2, HELN1, HEL-N1, Hu-antigen B, HuB, HUBELAV (embryonic lethal, abnormal vision, Drosophila)-like 2, Nervous system-specific RNA-binding protein Hel-N1
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols: ELAVL2
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: MAVRLCDVASLLRSGSWAAEPWTGQVIAAMETQLSNGPTCNNTANGPTTINNNCSSPVDSGNTEDSKTNL
Quantity: 0.1 mL
Research Discipline: Neuroscience, Vision
Gene ID (Entrez): 1993
Target Species: Human
Isotype: IgG
Antigen: TMEM92
Classification: Polyclonal
Dilution: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin 1:500 - 1:1000
Gene Alias: FLJ33318, transmembrane protein 92
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols: TMEM92
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: ELPSIIPPERVRVSLSAPPPPYSEVILKPSLGPTPTEPPPPYSFRPEEYTGDQ
Quantity: 0.1 mL
Research Discipline: __
Gene ID (Entrez): 162461
Target Species: Human
Isotype: IgG
Antigen: FAM177B
Classification: Polyclonal
Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500
Gene Alias: Family With Sequence Similarity 177, Member B, Protein FAM177B, RP11-452F19.2
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols: FAM177B
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: TQPKYQYVLNEFYRIQNKKSDNKSERRGSKAQAAEVPNEKCHLEAGVREYGTIQQDVTEAIPQ
Quantity: 0.1 mL
Research Discipline: __
Gene ID (Entrez): 400823
Target Species: Human
Isotype: IgG
