GRAF Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP238235-Each-of-1 | In Stock | ₹ 55,271.76 |
NBP238235 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 55,271.76
GST (18%): ₹ 9,948.917
Total Price: ₹ 65,220.677
Antigen
GRAF
Classification
Polyclonal
Dilution
Western Blot 0.4 ug/ml, Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:1000 - 1:2500
Gene Accession No.
Q9UNA1
Gene Symbols
ARHGAP26
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: RSSLHAVFSLLVNFVPCHPNLHLLFDRPEEAVHEDSSTPFRKAKALYACKAEHDSELSFTAGTVFDNVHPSQEPGWLE
Quantity
0.1 mL
Research Discipline
Neuroscience, Stem Cell Markers
Gene ID (Entrez)
23092
Target Species
Human
Isotype
IgG
Applications
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Formulation
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias
FLJ42530, GRAFGTPase regulator associated with focal adhesion kinase pp125(FAK), KIAA0621rho GTPase-activating protein 26, Oligophrenin-1-like protein, OPHN1L1, OPHN1LGTPase regulator associated with focal adhesion kinase, Rho GTPase activating protein 26, Rho-type GTPase-activating protein 26
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Related Products
Description
- Description GRAF Polyclonal specifically detects GRAF in Human samples
- It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: GRAF
Classification: Polyclonal
Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:1000 - 1:2500
Gene Accession No.: Q9UNA1
Gene Symbols: ARHGAP26
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: RSSLHAVFSLLVNFVPCHPNLHLLFDRPEEAVHEDSSTPFRKAKALYACKAEHDSELSFTAGTVFDNVHPSQEPGWLE
Quantity: 0.1 mL
Research Discipline: Neuroscience, Stem Cell Markers
Gene ID (Entrez): 23092
Target Species: Human
Isotype: IgG
Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: FLJ42530, GRAFGTPase regulator associated with focal adhesion kinase pp125(FAK), KIAA0621rho GTPase-activating protein 26, Oligophrenin-1-like protein, OPHN1L1, OPHN1LGTPase regulator associated with focal adhesion kinase, Rho GTPase activating protein 26, Rho-type GTPase-activating protein 26
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: __
Classification: __
Dilution: __
Gene Accession No.: __
Gene Symbols: __
Immunogen: RSSLHAVFSLLVNFVPCHPNLHLLFDRPEEAVHEDSSTPFRKAKALYACKAEHDSELSFTAGTVFDNVHPSQEPGWLE
Quantity: 0.1mL
Research Discipline: __
Gene ID (Entrez): 23092
Target Species: __
Isotype: __
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: __
Host Species: __
Purification Method: Chromatography
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
Antigen: SLC9A2
Classification: Polyclonal
Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000
Gene Accession No.: Q9UBY0
Gene Symbols: SLC9A2
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: SLRESIRKDSSLNREHRASTSTSRYLSLPKNTKLPEKLQKRRTISIADGNSSDSDADAGTTVLNLQPRARRFLPEQFSKKS
Quantity: 0.1 mL
Research Discipline: __
Gene ID (Entrez): 6549
Target Species: Human
Isotype: IgG
Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: solute carrier family 9 (sodium/hydrogen exchanger), solute carrier family 9 (sodium/hydrogen exchanger), member 2, solute carrier family 9 member 2
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.