CD34 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP238321-Each-of-1 | In Stock | ₹ 56,298.48 |
NBP238321 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 56,298.48
GST (18%): ₹ 10,133.726
Total Price: ₹ 66,432.206
Antigen
CD34
Classification
Polyclonal
Dilution
Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
Gene Accession No.
P28906
Gene Symbols
CD34
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: ATSPTKPYTSSSPILSDIKAEIKCSGIREVKLTQGICLEQNKTSSCAEFKKDRGEGLARVLCGEEQADADAG
Quantity
0.1 mL
Research Discipline
Adaptive Immunity, Angiogenesis, B Cell Development and Differentiation Markers, Breast Cancer, Cancer, Cell Biology, Cellular Markers, Endothelial Cell Markers, Hematopoietic Stem Cell Markers, Hypoxia, Immunology, Innate Immunity, Mast Cell Markers, Mesenchymal Stem Cell Markers, Myeloid Cell Markers, Myeloid derived Suppressor Cell, Neuronal Cell Markers, Neuroscience, Stem Cell Markers, Tumor Suppressors
Gene ID (Entrez)
947
Target Species
Human
Isotype
IgG
Applications
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Formulation
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias
CD34 antigenhematopoietic progenitor cell antigen CD34, CD34 molecule
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Related Products
Description
- CD34 Polyclonal specifically detects CD34 in Human samples
- It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: CD34
Classification: Polyclonal
Dilution: Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
Gene Accession No.: P28906
Gene Symbols: CD34
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: ATSPTKPYTSSSPILSDIKAEIKCSGIREVKLTQGICLEQNKTSSCAEFKKDRGEGLARVLCGEEQADADAG
Quantity: 0.1 mL
Research Discipline: Adaptive Immunity, Angiogenesis, B Cell Development and Differentiation Markers, Breast Cancer, Cancer, Cell Biology, Cellular Markers, Endothelial Cell Markers, Hematopoietic Stem Cell Markers, Hypoxia, Immunology, Innate Immunity, Mast Cell Markers, Mesenchymal Stem Cell Markers, Myeloid Cell Markers, Myeloid derived Suppressor Cell, Neuronal Cell Markers, Neuroscience, Stem Cell Markers, Tumor Suppressors
Gene ID (Entrez): 947
Target Species: Human
Isotype: IgG
Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: CD34 antigenhematopoietic progenitor cell antigen CD34, CD34 molecule
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: Rpn2
Classification: Polyclonal
Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500
Gene Accession No.: Q99460
Gene Symbols: PSMD1
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: GAFEESLNYALGAGDLFNVNDNSEYVETIIAKCIDHYTKQCVENADLPEGEKKPIDQRLEGIVNKMFQRCLDDHKYKQAIGIALE
Quantity: 0.1 mL
Research Discipline: Cell Cycle and Replication, Neuroscience, Ubiquitin Proteasome Pathway
Gene ID (Entrez): 5707
Target Species: Human
Isotype: IgG
Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: 26S proteasome non-ATPase regulatory subunit 1, 26S proteasome regulatory subunit RPN2, 26S proteasome regulatory subunit S1, 26S proteasome subunit p112, MGC133040, MGC133041, P112, proteasome (prosome, macropain) 26S subunit, non-ATPase, 1, Rpn2, S1
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: __
Classification: __
Dilution: __
Gene Accession No.: __
Gene Symbols: __
Immunogen: CAGTGNKEAINLLEPMTNDPVNYVRQGALIASALIMIQQTEITCPKVNQFRQLYSKVINDKHDDVMAKFGAILAQG
Quantity: 0.1mL
Research Discipline: __
Gene ID (Entrez): 5707
Target Species: __
Isotype: __
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: __
Host Species: __
Purification Method: Chromatography
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.