Peroxiredoxin 5 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP238371-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP238371 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
Peroxiredoxin 5
Classification
Polyclonal
Dilution
Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500
Gene Accession No.
P30044
Gene Symbols
PRDX5
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: NKVNLAELFKGKKGVLFGVPGAFTPGCSKTHLPGFVEQAEALKAKGVQVVACLSVNDAFVTGEWGRAHKAEGKV
Quantity
0.1 mL
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Formulation
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias
ACR1Peroxisomal antioxidant enzyme, Alu corepressor 1, Alu co-repressor 1, Antioxidant enzyme B166, AOEB166Peroxiredoxin V, B166, EC 1.11.1.15, Liver tissue 2D-page spot 71B, MGC117264, MGC142283, MGC142285, peroxiredoxin 5, peroxiredoxin-5, mitochondrial, PLPThioredoxin peroxidase PMP20, PMP20, PRDX6, prx-V, PRXV, SBBI10, Thioredoxin reductase, TPx type VI
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Gene ID (Entrez)
25824
Target Species
Human
Isotype
IgG
Related Products
Description
- Peroxiredoxin 5 Polyclonal specifically detects Peroxiredoxin 5 in Human samples
- It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: Peroxiredoxin 5
Classification: Polyclonal
Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500
Gene Accession No.: P30044
Gene Symbols: PRDX5
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: NKVNLAELFKGKKGVLFGVPGAFTPGCSKTHLPGFVEQAEALKAKGVQVVACLSVNDAFVTGEWGRAHKAEGKV
Quantity: 0.1 mL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: ACR1Peroxisomal antioxidant enzyme, Alu corepressor 1, Alu co-repressor 1, Antioxidant enzyme B166, AOEB166Peroxiredoxin V, B166, EC 1.11.1.15, Liver tissue 2D-page spot 71B, MGC117264, MGC142283, MGC142285, peroxiredoxin 5, peroxiredoxin-5, mitochondrial, PLPThioredoxin peroxidase PMP20, PMP20, PRDX6, prx-V, PRXV, SBBI10, Thioredoxin reductase, TPx type VI
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 25824
Target Species: Human
Isotype: IgG
Antigen: __
Classification: __
Dilution: __
Gene Accession No.: __
Gene Symbols: __
Immunogen: NKVNLAELFKGKKGVLFGVPGAFTPGCSKTHLPGFVEQAEALKAKGVQVVACLSVNDAFVTGEWGRAHKAEGKV
Quantity: 0.1mL
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: __
Host Species: __
Purification Method: Chromatography
Regulatory Status: RUO
Gene ID (Entrez): 25824
Target Species: __
Isotype: __
Antigen: ANKRD16
Classification: Polyclonal
Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000
Gene Accession No.: Q6P6B7
Gene Symbols: ANKRD16
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: KRCQYEPDYRDNCGVTALMDAIQCGHIDVARLLLDEHGACLSAEDSLGAQALHRAAVTGQDEAIRFLVSELGVDVDVRATSTHLTA
Quantity: 0.1 mL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: ankyrin repeat domain 16, ankyrin repeat domain-containing protein 16, DKFZP434N1511
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 54522
Target Species: Human
Isotype: IgG