ISCU Antibody, Novus Biologicals™
Manufacturer: Novus Biologicals
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP238420-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP238420 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
ISCU
Classification
Polyclonal
Dilution
Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500
Gene Accession No.
Q9H1K1
Gene Symbols
ISCU
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: TFGCGSAIASSSLATEWVKGKTVEEALTIKNTDIAKELCLPPVKLHCSMLAEDAIKAALADYKLKQEPK
Quantity
0.1 mL
Research Discipline
Proteases & Other Enzymes
Gene ID (Entrez)
23479
Target Species
Human
Isotype
IgG
Applications
Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Formulation
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias
2310020H20Rik, HML, hnifU, iron-sulfur cluster assembly enzyme ISCU, mitochondrial, iron-sulfur cluster scaffold homolog (E. coli), IscU, IscU iron-sulfur cluster scaffold homolog, IscU iron-sulfur cluster scaffold homolog (E. coli), ISU2, MGC74517, NIFU, NifU-like N-terminal domain containing, NifU-like N-terminal domain-containing protein, NifU-like protein, NIFUN
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Related Products
Description
- ISCU Polyclonal specifically detects ISCU in Human samples
- It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: ISCU
Classification: Polyclonal
Dilution: Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500
Gene Accession No.: Q9H1K1
Gene Symbols: ISCU
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: TFGCGSAIASSSLATEWVKGKTVEEALTIKNTDIAKELCLPPVKLHCSMLAEDAIKAALADYKLKQEPK
Quantity: 0.1 mL
Research Discipline: Proteases & Other Enzymes
Gene ID (Entrez): 23479
Target Species: Human
Isotype: IgG
Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: 2310020H20Rik, HML, hnifU, iron-sulfur cluster assembly enzyme ISCU, mitochondrial, iron-sulfur cluster scaffold homolog (E. coli), IscU, IscU iron-sulfur cluster scaffold homolog, IscU iron-sulfur cluster scaffold homolog (E. coli), ISU2, MGC74517, NIFU, NifU-like N-terminal domain containing, NifU-like N-terminal domain-containing protein, NifU-like protein, NIFUN
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: __
Classification: __
Dilution: __
Gene Accession No.: __
Gene Symbols: __
Immunogen: TFGCGSAIASSSLATEWVKGKTVEEALTIKNTDIAKELCLPPVKLHCSMLAEDAIKAALADYKLKQEPK
Quantity: 0.1mL
Research Discipline: __
Gene ID (Entrez): 23479
Target Species: __
Isotype: __
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: __
Host Species: __
Purification Method: Chromatography
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
Antigen: VGLL4
Classification: Polyclonal
Dilution: Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200, Knockdown Validated
Gene Accession No.: Q14135
Gene Symbols: VGLL4
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: EEHFRRSLGKNYKEPEPAPNSVSITGSVDDHFAKALGDTWLQIKAAKDGASSSPESASRRGQPASPSAHMVSHSHS
Quantity: 0.1 mL
Research Discipline: __
Gene ID (Entrez): 9686
Target Species: Human
Isotype: IgG
Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), KnockDown
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: KIAA0121transcription cofactor vestigial-like protein 4, vestigial like 4 (Drosophila), Vestigial-like 4, Vgl-4
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.