DYNC1I2 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP238469-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP238469 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
DYNC1I2
Classification
Polyclonal
Dilution
Western Blot 0.4 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500
Gene Accession No.
Q13409
Gene Symbols
DYNC1I2
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: HSDSDLGRGPIKLGMAKITQVDFPPREIVTYTKETQTPVMAQPKEDEEE
Quantity
0.1 mL
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Formulation
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias
cytoplasmic dynein 1 intermediate chain 2, Cytoplasmic dynein intermediate chain 2, DH IC-2, DNCI2MGC104199, DNCIC2, Dynein intermediate chain 2, cytosolic, dynein, cytoplasmic 1, intermediate chain 2, dynein, cytoplasmic, intermediate polypeptide 2, FLJ21089, FLJ90842, IC2, MGC111094, MGC9324
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Gene ID (Entrez)
1781
Target Species
Human
Isotype
IgG
Related Products
Description
- DYNC1I2 Polyclonal specifically detects DYNC1I2 in Human samples
- It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated.
Compare Similar Items
Show Difference
Antigen: DYNC1I2
Classification: Polyclonal
Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500
Gene Accession No.: Q13409
Gene Symbols: DYNC1I2
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: HSDSDLGRGPIKLGMAKITQVDFPPREIVTYTKETQTPVMAQPKEDEEE
Quantity: 0.1 mL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: cytoplasmic dynein 1 intermediate chain 2, Cytoplasmic dynein intermediate chain 2, DH IC-2, DNCI2MGC104199, DNCIC2, Dynein intermediate chain 2, cytosolic, dynein, cytoplasmic 1, intermediate chain 2, dynein, cytoplasmic, intermediate polypeptide 2, FLJ21089, FLJ90842, IC2, MGC111094, MGC9324
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 1781
Target Species: Human
Isotype: IgG
Antigen: __
Classification: __
Dilution: __
Gene Accession No.: __
Gene Symbols: __
Immunogen: HSDSDLGRGPIKLGMAKITQVDFPPREIVTYTKETQTPVMAQPKEDEEE
Quantity: 0.1mL
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: __
Host Species: __
Purification Method: Chromatography
Regulatory Status: RUO
Gene ID (Entrez): 1781
Target Species: __
Isotype: __
Antigen: ATP5A
Classification: Polyclonal
Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50
Gene Accession No.: P25705
Gene Symbols: ATP5F1A
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: QRELIIGDRQTGKTSIAIDTIINQKRFNDGSDEKKKLYCIYVAIGQKRSTVAQLVKRLTDADAMKYTIVVSATASDAAPLQYLAP
Quantity: 0.1 mL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: ATP synthase, H+ transporting, mitochondrial F1 complex, alpha subunit 1, ATP synthase, H+ transporting, mitochondrial F1 complex, alpha subunit, isoform1, cardiac muscle, ATP synthase, H+ transporting, mitochondrial F1 complex, alpha subunit, isoform2, non-cardiac muscle-like 2, ATP sythase (F1-ATPase) alpha subunit, ATP5AL2, ATP5AMOM2, ATPMATP synthase subunit alpha, mitochondrial, cardiac muscle, EC 3.6.3, EC 3.6.3.14, hATP1, mitochondrial ATP synthetase, oligomycin-resistant, OMR, ORMATP synthase alpha chain, mitochondrial
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 498
Target Species: Human
Isotype: IgG