Karyopherin (importin) beta 3 Antibody, Novus Biologicals™
Manufacturer: Novus Biologicals
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP238480-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP238480 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
Karyopherin (importin) beta 3
Classification
Polyclonal
Dilution
Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50
Gene Accession No.
O00410
Gene Symbols
IPO5
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: AAEQQQFYLLLGNLLSPDNVVRKQAEETYEN
Quantity
0.1 mL
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Formulation
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias
DKFZp686O1576, FLJ43041, IMB3, imp5, importin 5, importin beta-3 subunit, Importin subunit beta-3, importin-5, karyopherin (importin) beta 3, Karyopherin beta-3, KPNB3, MGC2068, RAN binding protein 5, Ran_GTP binding protein 5, Ran-binding protein 5, RANBP5
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Gene ID (Entrez)
3843
Target Species
Human
Isotype
IgG
Related Products
Description
- Description Karyopherin (importin) beta 3 Polyclonal specifically detects Karyopherin (importin) beta 3 in Human samples
- It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: Karyopherin (importin) beta 3
Classification: Polyclonal
Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50
Gene Accession No.: O00410
Gene Symbols: IPO5
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: AAEQQQFYLLLGNLLSPDNVVRKQAEETYEN
Quantity: 0.1 mL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: DKFZp686O1576, FLJ43041, IMB3, imp5, importin 5, importin beta-3 subunit, Importin subunit beta-3, importin-5, karyopherin (importin) beta 3, Karyopherin beta-3, KPNB3, MGC2068, RAN binding protein 5, Ran_GTP binding protein 5, Ran-binding protein 5, RANBP5
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 3843
Target Species: Human
Isotype: IgG
Antigen: __
Classification: __
Dilution: __
Gene Accession No.: __
Gene Symbols: __
Immunogen: AAEQQQFYLLLGNLLSPDNVVRKQAEETYEN
Quantity: 0.1mL
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: __
Host Species: __
Purification Method: Chromatography
Regulatory Status: RUO
Gene ID (Entrez): 3843
Target Species: __
Isotype: __
Antigen: IL-18 BPa/IL18BP
Classification: Polyclonal
Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000
Gene Accession No.: O95998
Gene Symbols: IL18BP
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: RLWEGSTSRERGSTGTQLCKALVLEQLTPALHSTNFSCVLVDPEQVVQRHVVLAQLWAGLRATLPPTQEALPSSHSSPQQQG
Quantity: 0.1 mL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: IL-18BP, IL18BPa, interleukin 18 binding protein, interleukin-18-binding protein, MC51L-53L-54L homolog gene product, tadekinig-alfa
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 10068
Target Species: Human
Isotype: IgG