PI 3-Kinase p110 delta Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP238535-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP238535 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
PI 3-Kinase p110 delta
Classification
Polyclonal
Dilution
Western Blot 0.4 ug/ml, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500
Gene Alias
EC 2.7.1, EC 2.7.1.153, p110D, P110DELTA, Phosphatidylinositol-4,5-bisphosphate 3-kinase 110 kDa catalytic subunit delta, phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit delta isoform, phosphoinositide-3-kinase C, phosphoinositide-3-kinase, catalytic, delta polypeptide, PI3K, PI3K-delta, PI3-kinase p110 subunit delta, PI3-kinase subunit delta, PtdIns-3-kinase subunit delta, PtdIns-3-kinase subunit p110-delta
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Formulation
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols
PIK3CD
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: AECSRLLQILELGRHSECVHVTEEEQLQLREILERRGSGELYEHEKDLVWKLRHEVQEHFPEALARLLLVTKWN
Quantity
0.1 mL
Research Discipline
Autophagy, mTOR Pathway, Signal Transduction
Gene ID (Entrez)
5293
Target Species
Human
Isotype
IgG
Related Products
Description
- PI 3-Kinase p110 delta Polyclonal specifically detects PI 3-Kinase p110 delta in Human samples
- It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: PI 3-Kinase p110 delta
Classification: Polyclonal
Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500
Gene Alias: EC 2.7.1, EC 2.7.1.153, p110D, P110DELTA, Phosphatidylinositol-4,5-bisphosphate 3-kinase 110 kDa catalytic subunit delta, phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit delta isoform, phosphoinositide-3-kinase C, phosphoinositide-3-kinase, catalytic, delta polypeptide, PI3K, PI3K-delta, PI3-kinase p110 subunit delta, PI3-kinase subunit delta, PtdIns-3-kinase subunit delta, PtdIns-3-kinase subunit p110-delta
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols: PIK3CD
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: AECSRLLQILELGRHSECVHVTEEEQLQLREILERRGSGELYEHEKDLVWKLRHEVQEHFPEALARLLLVTKWN
Quantity: 0.1 mL
Research Discipline: Autophagy, mTOR Pathway, Signal Transduction
Gene ID (Entrez): 5293
Target Species: Human
Isotype: IgG
Antigen: __
Classification: __
Dilution: __
Gene Alias: __
Host Species: __
Purification Method: Chromatography
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: AECSRLLQILELGRHSECVHVTEEEQLQLREILERRGSGELYEHEKDLVWKLRHEVQEHFPEALARLLLVTKWN
Quantity: 0.1mL
Research Discipline: __
Gene ID (Entrez): 5293
Target Species: __
Isotype: __
Antigen: Cytokeratin 17
Classification: Polyclonal
Dilution: Western Blot 0.04 - 0.4 ug/ml, Immunohistochemistry 1:20 - 1:50, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:20 - 1:50
Gene Alias: 39.1, CK-17, cytokeratin-17, K17, keratin 17, keratin, type I cytoskeletal 17, keratin-17, PC, PC2, PCHC1
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols: KRT17
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: SSRTSCRLSGGLGAGSCRLGSAGGL
Quantity: 0.1 mL
Research Discipline: Cancer
Gene ID (Entrez): 3872
Target Species: Human
Isotype: IgG
