non-muscle heavy chain 10 Myosin Antibody, Novus Biologicals™
Manufacturer: Novus Biologicals
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP238566-Each-of-1 | In Stock | ₹ 55,271.76 |
NBP238566 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 55,271.76
GST (18%): ₹ 9,948.917
Total Price: ₹ 65,220.677
Antigen
non-muscle heavy chain 10 Myosin
Classification
Polyclonal
Dilution
Western Blot 0.4 ug/ml, Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000
Gene Accession No.
P35580
Gene Symbols
MYH10
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: RQLDDATEANEGLSREVSTLKNRLRRGGPISFSSSRSGRRQLHLEGASLELSDDDTESKTSDVNETQPPQ
Quantity
0.1 mL
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Formulation
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias
Cellular myosin heavy chain, type B, cellular myosin heavy chain, type B type B, heavy polypeptide 10, non-muscle, MGC134913, MGC134914, Myosin heavy chain 10, Myosin heavy chain, non-muscle IIb, myosin heavy chain, nonmuscle type B, myosin, heavy chain 10, non-muscle, myosin-10, near to the ATP binding region, NMMHC II-b, NMMHCB, NMMHC-B, NMMHC-IIB, Non-muscle myosin heavy chain B, nonmuscle myosin heavy chain IIB, Non-muscle myosin heavy chain IIb, nonmuscle myosin heavy chain-B, nonmuscle myosin II heavy chain-B
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Gene ID (Entrez)
4628
Target Species
Human
Isotype
IgG
Related Products
Description
- Description non-muscle heavy chain 10 Myosin Polyclonal specifically detects non-muscle heavy chain 10 Myosin in Human samples
- It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: non-muscle heavy chain 10 Myosin
Classification: Polyclonal
Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000
Gene Accession No.: P35580
Gene Symbols: MYH10
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: RQLDDATEANEGLSREVSTLKNRLRRGGPISFSSSRSGRRQLHLEGASLELSDDDTESKTSDVNETQPPQ
Quantity: 0.1 mL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: Cellular myosin heavy chain, type B, cellular myosin heavy chain, type B type B, heavy polypeptide 10, non-muscle, MGC134913, MGC134914, Myosin heavy chain 10, Myosin heavy chain, non-muscle IIb, myosin heavy chain, nonmuscle type B, myosin, heavy chain 10, non-muscle, myosin-10, near to the ATP binding region, NMMHC II-b, NMMHCB, NMMHC-B, NMMHC-IIB, Non-muscle myosin heavy chain B, nonmuscle myosin heavy chain IIB, Non-muscle myosin heavy chain IIb, nonmuscle myosin heavy chain-B, nonmuscle myosin II heavy chain-B
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 4628
Target Species: Human
Isotype: IgG
Antigen: __
Classification: __
Dilution: __
Gene Accession No.: __
Gene Symbols: __
Immunogen: RQLDDATEANEGLSREVSTLKNRLRRGGPISFSSSRSGRRQLHLEGASLELSDDDTESKTSDVNETQPPQ
Quantity: 0.1mL
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: __
Host Species: __
Purification Method: Chromatography
Regulatory Status: RUO
Gene ID (Entrez): 4628
Target Species: __
Isotype: __
Antigen: __
Classification: __
Dilution: __
Gene Accession No.: __
Gene Symbols: __
Immunogen: PPYFVALVPQEEELDDQKIQVTPPGFQLVFLPFADDKRKMPFTEKIMATPEQVGKMKAIVEKLRFTYRSDSFENPVLQQHFRNLEALALDLMEPEQAVDL
Quantity: 0.1mL
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: __
Host Species: __
Purification Method: Chromatography
Regulatory Status: RUO
Gene ID (Entrez): 2547
Target Species: __
Isotype: __