ACBP Antibody, Novus Biologicals™
Manufacturer: Novus Biologicals
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP238648-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP238648 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
ACBP
Classification
Polyclonal
Dilution
Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500
Gene Accession No.
P07108
Gene Symbols
DBI
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: MSQAEFEKAAEEVRHLKTKPSDEEMLFIYGHYKQATVGD
Quantity
0.1 mL
Research Discipline
Cancer
Gene ID (Entrez)
1622
Target Species
Human
Isotype
IgG
Applications
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Formulation
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias
acyl-Coenzyme A binding domain containing 1, acyl-Coenzyme A bindingprotein), CCK-RP, cholecystokinin-releasing peptide, trypsin-sensitive, diazepam binding inhibitor (GABA receptor modulator, acyl-CoA binding protein), Diazepam-binding inhibitor, endozepine, EP, GABA receptor modulator, MGC70414
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Related Products
Description
- ACBP Polyclonal specifically detects ACBP in Human samples
- It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: ACBP
Classification: Polyclonal
Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500
Gene Accession No.: P07108
Gene Symbols: DBI
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: MSQAEFEKAAEEVRHLKTKPSDEEMLFIYGHYKQATVGD
Quantity: 0.1 mL
Research Discipline: Cancer
Gene ID (Entrez): 1622
Target Species: Human
Isotype: IgG
Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: acyl-Coenzyme A binding domain containing 1, acyl-Coenzyme A bindingprotein), CCK-RP, cholecystokinin-releasing peptide, trypsin-sensitive, diazepam binding inhibitor (GABA receptor modulator, acyl-CoA binding protein), Diazepam-binding inhibitor, endozepine, EP, GABA receptor modulator, MGC70414
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: __
Classification: __
Dilution: __
Gene Accession No.: __
Gene Symbols: __
Immunogen: MSQAEFEKAAEEVRHLKTKPSDEEMLFIYGHYKQATVGD
Quantity: 0.1mL
Research Discipline: __
Gene ID (Entrez): 1622
Target Species: __
Isotype: __
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: __
Host Species: __
Purification Method: Chromatography
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
Antigen: MMP-14/MT1-MMP
Classification: Polyclonal
Dilution: Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:20 - 1:50
Gene Accession No.: P50281
Gene Symbols: MMP14
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: HWVFDEASLEPGYPKHIKELGRGLPTDKIDAALFWMPNGKTYFFRGNKYYRFNEELRAVDSEYPKNIKVWEG
Quantity: 0.1 mL
Research Discipline: Cancer, Extracellular Matrix
Gene ID (Entrez): 4323
Target Species: Human
Isotype: IgG
Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: EC 3.4.24, EC 3.4.24.80, matrix metallopeptidase 14 (membrane-inserted), matrix metalloproteinase 14 (membrane-inserted), matrix metalloproteinase-14, membrane type 1 metalloprotease, Membrane-type matrix metalloproteinase 1, Membrane-type-1 matrix metalloproteinase, MMP-14, MMP-X1, MT1MMP, MT1-MMPMTMMP1, MT-MMP 1
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.